KEGG   Bacillus subtilis PY79: U712_10980Help
Entry
U712_10980        CDS       T02937                                 

Definition
(GenBank) N-(5'-phosphoribosyl)anthranilate isomerase
  KO
K01817  phosphoribosylanthranilate isomerase [EC:5.3.1.24]
Organism
bsp  Bacillus subtilis PY79
Pathway
bsp00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bsp01100  Metabolic pathways
bsp01110  Biosynthesis of secondary metabolites
bsp01130  Biosynthesis of antibiotics
bsp01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bsp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    U712_10980
Enzymes [BR:bsp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     U712_10980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRAI RE_MjaI
Motif
Other DBs
NCBI-ProteinID: AHA78139
LinkDB All DBs
Position
complement(2191349..2191996)
Genome map
AA seq 215 aa AA seqDB search
MKKPALKYCGIRSLQDLQLAADSQADYLGFIFAESYRKVSPQDVKKWLSQVCVEKQVAGV
FVNESIETMSRIAEDLNLDVIQLHGDEEPADADALRMLTDCEIWKALHHHENTTQEIARF
KDDVDGFVIDSSVKGARGGTGVAFSWDCVPEYQQAAIGKRCFIAGGVNPDTITDLMKYQP
AGIDLASGIEKNGQKDQNLMRLLEERMNRYVSISE
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaagccggcattaaaatattgcggcatacggtcactgcaggatttgcagcttgca
gcagactcacaggcggattatctgggctttatttttgctgaaagctaccgaaaagtatct
ccgcaagatgtgaaaaagtggctgagtcaagtttgtgtcgaaaaacaggttgcaggggtt
tttgttaatgaatcgatagagacgatgtcacggattgccgaagacttaaatctagacgtc
attcagcttcacggtgatgaggaacctgcggatgccgatgcgcttcgcatgctgacagat
tgtgaaatatggaaggcgcttcaccatcatgagaacacaactcaagagatagcccgcttt
aaagatgatgtggacggctttgtgattgattcatctgtcaaaggggcaagagggggcact
ggtgttgctttttcttgggactgtgtgccggaataccagcaggctgctataggaaaacgt
tgttttatcgcaggcggcgtgaatccggacactatcacagacttaatgaaatatcagccg
gcaggaattgaccttgccagcggaatcgaaaaaaacggacaaaaagatcagaatctgatg
aggcttttagaagaaaggatgaatcgatatgtatccatatccgaatga

DBGET integrated database retrieval system