KEGG   Bacillus subtilis PY79: U712_11595Help
Entry
U712_11595        CDS       T02937                                 

Definition
(GenBank) Pyrroline-5-carboxylate reductase 2
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
bsp  Bacillus subtilis PY79
Pathway
bsp00330  Arginine and proline metabolism
bsp01100  Metabolic pathways
bsp01110  Biosynthesis of secondary metabolites
bsp01230  Biosynthesis of amino acids
Module
bsp_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:bsp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    U712_11595
Enzymes [BR:bsp01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     U712_11595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored Shikimate_DH ApbA NAD_binding_2 GFO_IDH_MocA Sugar-bind Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: AHA78260
LinkDB All DBs
Position
2291019..2291855
Genome map
AA seq 278 aa AA seqDB search
MKKIGFVGAGSMAEAMINGILQSGITKPEHIYITNRSNDERLIELKETYSVRPCRDKNEF
FTHTDIIILAFKPKDAAESIDSIRPYIKDQLVISVLAGLTIETIQHYFGRKLAVIRVMPN
TSAAIRKSATGFSVSTEASKNDIIAAKALLETIGDATLVEERHLDAVTAIAGSGPAYVYR
YIEAMEKAAQKVGLDKETAKALILQTMAGATDMLLQSGKQPEKLRKEITSPGGTTEAGLR
ALQDSRFEEAIIHCIEETAKRSAEIKEQFAGAALERHS
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagataggatttgtcggcgccgggtcaatggcagaagcaatgatcaacggcatt
ttgcaaagcggcatcacaaaaccagaacatatctatattacaaatcgctcaaatgacgag
cgtctgattgaattaaaggaaacgtacagcgtgcgtccatgcagagataaaaatgagttt
ttcactcacaccgatatcattatcctcgctttcaaaccgaaagacgcggcggaaagcatc
gacagcatccggccgtatatcaaggaccagcttgtcatttcagtacttgcaggccttacc
atcgaaaccattcagcattattttggcagaaagctcgcggtcattcgcgtcatgcctaat
acatcagcggcaatcagaaaatcagcaaccggattttccgtaagcacggaagcaagcaag
aatgatattattgccgcaaaagctctattggaaacaatcggtgatgcaacactggttgag
gagcggcatcttgacgctgtcactgcaatcgcaggcagcggcccggcctatgtgtatcgt
tatattgaggcgatggaaaaagcagcacaaaaagtaggattagataaagaaacggcaaaa
gcactcattttgcagacaatggcaggggcaacagatatgctcctccaaagcggcaaacag
ccggaaaagctgcgtaaagaaatcaccagtcctgggggcactacagaggcaggtcttcgc
gctttacaggactcccgctttgaagaagcaattattcactgtattgaagaaacagctaaa
cggagcgcagaaatcaaagaacagtttgccggtgccgccttagagagacattcttag

DBGET integrated database retrieval system