KEGG   Bacillus subtilis PY79: U712_11655Help
Entry
U712_11655        CDS       T02937                                 

Definition
(GenBank) Putative propionyl-CoA carboxylase beta chain
  KO
K01966  propionyl-CoA carboxylase beta chain [EC:6.4.1.3 2.1.3.15]
Organism
bsp  Bacillus subtilis PY79
Pathway
bsp00280  Valine, leucine and isoleucine degradation
bsp00630  Glyoxylate and dicarboxylate metabolism
bsp00640  Propanoate metabolism
bsp01100  Metabolic pathways
bsp01110  Biosynthesis of secondary metabolites
bsp01120  Microbial metabolism in diverse environments
bsp01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bsp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    U712_11655
   00640 Propanoate metabolism
    U712_11655
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    U712_11655
Enzymes [BR:bsp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     U712_11655
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.3  propionyl-CoA carboxylase
     U712_11655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Carboxyl_trans MdcE BIV_Env
Motif
Other DBs
NCBI-ProteinID: AHA78272
LinkDB All DBs
Position
complement(2304679..2306208)
Genome map
AA seq 509 aa AA seqDB search
MSMNEHMDHFYTKRKQAEEGGGREKLAQQRQKGKLTARERIIFLLDQDSFIELHPFMESQ
VLTREQRMLGDGVVTGYGTIDGRSVYVFAQDFTVYGGALGETHARKICALMDLAAKNKAP
IIGLNDSGGARIQEGVLSLDGYGHIFYRNVLYSGVIPQISVILGPCAGGAVYSPALTDFI
FMAEQTGRMFITGPKVIEKVTGEQVDAESLGGAGIHNAVSGNAHFSGHTEKEVLTGVRKL
LSYLPLNGRTTEPKPEKEASRPLLNRLVPADTTKPYDVRKVIRELADPQSFFEIQPFFAK
NIVIGFARLGEKAIGIVASQPKHLAGSLTIDAADKAARFIRFCDAFDIPLLTVEDVPGFL
PGIQQEHNGIIRHGAKLLFAYAEATVPKVTLIIRKAYGGAYVAMNSKAIGADLVFAWPNA
EIAVMGPEGAASILYEKEIKASADPQKTKREKTAEYKKQNAGPYKAAACGMVDDIILPEE
SRGRLIQAFHMLTHKTEERPKKKHGNIPL
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgagcatgaatgagcacatggatcatttttacacgaaacgcaagcaggcagaagaaggc
ggaggacgggaaaagctggctcagcagcggcaaaagggcaagctcactgctcgggaaagg
atcatatttcttctagatcaggacagctttatcgaattacaccccttcatggaaagtcaa
gtgttaacaagagaacagcgcatgttaggggatggggtcgtgacagggtacggcacaatt
gacggtcgctcagtttatgtatttgcgcaagacttcacagtgtacggaggggcgcttggc
gaaacccatgccaggaaaatctgcgctttgatggatctggcagcaaaaaataaggcgccg
attatcgggctgaatgactcaggtggtgcgagaattcaagagggtgtgttatcattagat
ggatacggtcacatattttaccgaaacgtcttatattccggagtcattccgcaaatatcg
gttattttagggccgtgcgctggaggcgctgtatattctccggcactcacagattttata
tttatggctgaacagactggccggatgtttattaccggcccgaaggtgattgaaaaagtg
acaggggaacaggttgatgcggagagcttaggcggagcggggatacataatgccgtcagc
ggaaacgcccacttttccgggcatacggagaaggaggttctgacaggggtgagaaaacta
ctgtcttatttgccgctgaatggccggacaacagagccgaagccagagaaagaggcgtcc
agaccgttattaaaccgtcttgtccctgctgatacgacaaagccttatgatgttcggaag
gtgattagggagctggctgacccgcagtctttttttgagattcagccattttttgcgaag
aacattgtcattgggtttgcaaggctgggtgaaaaagcaatcggcatcgtggcgagccag
ccgaagcatctggcgggaagcctgacgattgacgctgctgataaagcagcaaggttcatc
cgtttttgtgacgcatttgatatcccgctgttgactgtcgaagatgtcccggggtttctg
ccgggtattcagcaagagcacaacggaatcatcaggcatggagcaaaattattgtttgct
tatgctgaagcgactgtcccaaaagtcacactcatcattagaaaagcgtacggcggcgcc
tatgtggccatgaacagcaaagcgatcggagcggaccttgtgtttgcatggccgaatgct
gaaatcgcagtgatgggtccagaaggtgcggcatcgattttgtatgaaaaggaaatcaaa
gcttcagctgacccgcaaaagacgaaacgcgaaaaaactgctgaatacaaaaagcaaaac
gccggcccatacaaagcggccgcttgtggaatggtcgatgacatcattttgccggaagaa
tcaaggggaagactgattcaagcttttcatatgcttacacataagacagaagagagaccg
aaaaaaaagcacggtaacataccgctttaa

DBGET integrated database retrieval system