KEGG   Bacillus subtilis PY79: U712_11675Help
Entry
U712_11675        CDS       T02937                                 

Definition
(GenBank) Arginine transport ATP-binding protein ArtM
  KO
K23060  arginine/lysine/histidine transport system ATP-binding protein [EC:7.4.2.1]
Organism
bsp  Bacillus subtilis PY79
Pathway
bsp02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsp00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    U712_11675
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsp02000]
    U712_11675
Enzymes [BR:bsp01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.1  ABC-type polar-amino-acid transporter
     U712_11675
Transporters [BR:bsp02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Arginine/lysine/histidine transporter
    U712_11675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_15 AAA_16 T2SSE AAA_29 RsgA_GTPase AAA_22 AAA_13 AAA_33 ABC_ATPase AAA_23 AAA_25 G-alpha AAA_24 IIGP SbcCD_C CobU AAA_18 AAA_30 Mg_chelatase DUF87 PRK DEAD ATP_bind_1 NACHT FtsK_SpoIIIE MMR_HSR1
Motif
Other DBs
NCBI-ProteinID: AHA78276
LinkDB All DBs
Position
complement(2308440..2309162)
Genome map
AA seq 240 aa AA seqDB search
MIKVEKLSKSFGKHEVLKNISTTIAEGEVVAVIGPSGSGKSTFLRCLNLLEKPNGGTITI
KDTEITKPKTNTLKVRENIGMVFQHFHLFPHKTVLENIMYAPVNVKKESKQAAQEKAEDL
LRKVGLFEKRNDYPNRLSGGQKQRVAIARALAMNPDIMLFDEPTSALDPEMVKEVLQVMK
ELVETGMTMVIVTHEMGFAKEVADRVLFMDQGMIVEDGNPKEFFMSPKSKRAQDFLEKIL
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgattaaggttgaaaagctgtcaaaatcatttgggaaacacgaagtattaaaaaacatt
tcaacaacaatcgctgagggtgaggttgttgccgtgatcggtccttcaggctcaggcaaa
tcaacgttcttacgctgtttaaacctgttggaaaagcctaacggcggaaccattacaata
aaagacacagagattacgaagccgaaaaccaacacattaaaggtccgggaaaacatcggg
atggtttttcagcattttcatctctttccgcacaaaacggttctcgaaaacatcatgtac
gcgcctgtcaatgtaaaaaaagaatcaaaacaggctgcacaggagaaagctgaggacctg
ctccgcaaagtcggtttgtttgaaaagcgaaatgactatccaaaccgtttgtctggcgga
caaaaacagcgtgtcgcgattgccagggctcttgcgatgaatccggacatcatgctgttt
gacgagccgacctccgcccttgatccagagatggtcaaagaagtgctacaggtgatgaaa
gagctggtcgaaaccggcatgaccatggtgattgtcacacatgaaatgggcttcgcaaaa
gaagtggcagaccgtgtgctgtttatggaccaaggaatgattgtcgaagacggcaatccg
aaggaattttttatgtcgccaaaatccaaaagagcgcaggactttttagagaaaatatta
tag

DBGET integrated database retrieval system