KEGG   Bacillus subtilis PY79: U712_11855Help
Entry
U712_11855        CDS       T02937                                 

Definition
(GenBank) Exodeoxyribonuclease 7 small subunit
  KO
K03602  exodeoxyribonuclease VII small subunit [EC:3.1.11.6]
Organism
bsp  Bacillus subtilis PY79
Pathway
bsp03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:bsp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    U712_11855
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsp03400]
    U712_11855
Enzymes [BR:bsp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.6  exodeoxyribonuclease VII
     U712_11855
DNA repair and recombination proteins [BR:bsp03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA exonucleases
     U712_11855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Exonuc_VII_S
Motif
Other DBs
NCBI-ProteinID: AHA78312
LinkDB All DBs
Position
complement(2344535..2344789)
Genome map
AA seq 84 aa AA seqDB search
MTDVKKNENMTFEEAMKGLESIVSKLEEGDVPLEQAINYFQEGMALSKMCHEKLQKVEKQ
MDFILKEDGELAPFSVQEEDEGDK
NT seq 255 nt NT seq  +upstreamnt  +downstreamnt
atgacagacgtgaaaaaaaatgaaaacatgacatttgaagaagcgatgaaagggcttgag
agcattgtatcaaagcttgaagagggagatgtgcctctagagcaagccattaactatttc
caagaaggcatggctctgtcaaaaatgtgccatgaaaagctgcaaaaagtcgaaaagcaa
atggacttcattttaaaagaagacggcgaactggcacctttcagtgttcaggaggaagac
gaaggtgacaaataa

DBGET integrated database retrieval system