KEGG   Bacillus subtilis PY79: U712_11985Help
Entry
U712_11985        CDS       T02937                                 

Definition
(GenBank) putative glycine dehydrogenase [decarboxylating] subunit 2
  KO
K00283  glycine dehydrogenase subunit 2 [EC:1.4.4.2]
Organism
bsp  Bacillus subtilis PY79
Pathway
bsp00260  Glycine, serine and threonine metabolism
bsp00630  Glyoxylate and dicarboxylate metabolism
bsp01100  Metabolic pathways
bsp01110  Biosynthesis of secondary metabolites
bsp01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bsp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    U712_11985
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    U712_11985
Enzymes [BR:bsp01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.4  With a disulfide as acceptor
    1.4.4.2  glycine dehydrogenase (aminomethyl-transferring)
     U712_11985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDC-P Aminotran_5 Beta_elim_lyase DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: AHA78338
LinkDB All DBs
Position
complement(2363276..2364742)
Genome map
AA seq 488 aa AA seqDB search
MSNQDQALIFELSREGRIGYSLPELDVPEIELGDLLSDTYIRDEDAALPEVSELDIMRHY
TALSKRNHGVDSGFYPLGSCTMKYNPKINEKIARIPGFAAIHPLQDEDTVQGALELLYDL
SKHLEEITGMDEVTLQPAAGAHGEWTGLMMIRAYHEARGDFKRTKVIVPDSAHGTNPASA
TVAGFETVTVKSNEKGLVDLEDLKRAVNEETAALMLTNPNTLGLFEEQITEMAEIVHQAG
GKLYYDGANLNAVLSKARPGDMGFDVVHLNLHKTFTGPHGGGGPGSGPVGVKQDLIPYLP
KPVLVKKEGRFTFDYDRPHAIGRVKPYYGNFGINVRAYTYIRSMGPDGLKAVTENAVLNA
NYMMRKLAPYYDLPFDRHCKHEFVLSGKRQKKLGVRTLDIAKRLLDFGYHPPTIYFPLNV
EECIMIEPTETESKETLDAFIDAMIQIAKEAEENPELVQEAPHTTIVKRMDETKAARHPV
LRYEAEER
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatcaggaccaggcacttatttttgaactttcaagagaaggccgaatcggctat
agtctgccggagctcgatgtaccggaaatcgaattgggggacctcttgtcagacacctat
attcgtgacgaagacgcagcgctgccggaggtttcagagctggacatcatgcgccattat
acagcgctgtccaaacgcaatcacggggtggattccggtttttatcctctcggttcttgc
acgatgaaatataatccgaaaatcaatgaaaaaatcgcacgtattcctggttttgctgcg
attcatcctcttcaggatgaagacacggtgcaaggcgcattagagcttttatatgattta
agcaaacaccttgaagaaataacgggaatggatgaggttacgcttcagcctgctgccgga
gcgcacggcgaatggacggggctgatgatgatccgtgcctatcatgaagctcgcggggat
ttcaagcggacgaaggtcattgtccctgattccgcgcatgggacgaatcctgcatcagca
acagtagcaggctttgaaaccgttacggtgaaatcgaatgaaaaagggcttgttgattta
gaggatttaaaaagagcagtgaatgaagaaactgcagctcttatgctgacgaatccgaac
acgctcggcttgtttgaggagcagattacagagatggcggaaattgtacaccaagcgggg
gggaaactgtattatgacggcgctaatttaaatgccgttttaagcaaggcgagacctggt
gatatgggatttgacgtggtgcacctcaacctgcataaaacattcacaggccctcatggc
ggcggaggccccggctcaggccctgtcggcgtaaaacaagatctgattccttatttgcca
aagccagttttagtcaaaaaagaagggcgctttacgtttgattatgaccgccctcatgcg
atcggccgtgtgaagccgtattacggcaactttggcattaatgtgagagcgtatacgtat
attcgctccatggggcctgacggattaaaggctgttactgagaacgcagtgttaaacgcc
aattatatgatgagaaaactcgcgccttattacgatcttccgtttgaccgccattgcaag
catgaatttgtattatcagggaagcggcagaaaaagctgggagtgcgtacgcttgatatt
gcaaaacggctccttgatttcggctatcatccgccgacgatttatttcccgcttaatgtt
gaagaatgcatcatgatcgagccgacagagaccgaatcaaaggaaacactggacgcgttt
attgatgctatgattcaaatcgcaaaagaagcggaggagaatccggagcttgttcaggag
gccccgcatacaacgattgtaaaaagaatggatgaaacaaaagcggcgagacacccagtg
ctcagatacgaggcggaagaaagataa

DBGET integrated database retrieval system