KEGG   Bacillus subtilis PY79: U712_12055Help
Entry
U712_12055        CDS       T02937                                 

Definition
(GenBank) ComG operon protein 5
Organism
bsp  Bacillus subtilis PY79
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AHA78352
LinkDB All DBs
Position
complement(2374787..2375134)
Genome map
AA seq 115 aa AA seqDB search
MWRENKGFSTIETMSALSLWLFVLLTVVPLWDKLMADEKMAESREIGYQMMNESISKYVM
SGEGAASKTITKNNHIYAMKWEEEGEYQNVCIKAAAYKEKSFCLSILQTEWLHAS
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgtggagagaaaataaaggtttttctacaatagaaacaatgtctgcgctaagcctgtgg
ctgtttgtgctgctgacagtcgtccccttgtgggacaagctgatggctgatgaaaaaatg
gcggaatcacgagaaattggctatcagatgatgaatgagagcattagcaaatatgtcatg
agtggtgaaggagccgcgtcaaaaacgattacaaagaacaatcatatctatgcaatgaag
tgggaggaggagggcgaatatcaaaacgtatgtatcaaagccgcagcttataaagaaaaa
tcattttgcctcagcattttgcagacagaatggctacacgcttcttaa

DBGET integrated database retrieval system