KEGG   Bacillus subtilis PY79: U712_12060Help
Entry
U712_12060        CDS       T02937                                 

Definition
(GenBank) ComG operon protein 4
  KO
K02246  competence protein ComGD
Organism
bsp  Bacillus subtilis PY79
Brite
KEGG Orthology (KO) [BR:bsp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bsp02044]
    U712_12060
Secretion system [BR:bsp02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) core components
   U712_12060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: N_methyl
Motif
Other DBs
NCBI-ProteinID: AHA78353
LinkDB All DBs
Position
complement(2375118..2375549)
Genome map
AA seq 143 aa AA seqDB search
MNIKLNEEKGFTLLESLLVLSLASILLVAVFTTLPPAYDNTAVRQAASQLKNDIMLTQQT
AISRQQRTKILFHKKEYQLVIGDTVIERPYATGLSIELLTLKDRLEFNEKGHPNAGGKIR
VKGHAVYDITVYLGSGRVNVERK
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
ttgaacattaaattaaacgaggagaaggggtttacccttttagaaagtttgcttgtgtta
agccttgcctctatcctcctggtggccgtcttcactacacttcctcctgcttatgacaat
acagctgtccgacaggcagcaagtcagctgaaaaatgatattatgctcacacagcagact
gctatttcccgtcaacaaagaacaaaaattctctttcataaaaaagaatatcaattagtc
attggtgatacggttattgaacgtccgtatgcaacgggactttctatagaactgctgaca
ttaaaagaccgtttggaatttaatgagaaagggcacccgaatgcaggcggaaaaatacga
gtaaaaggccatgccgtttatgacataacagtttatctagggagcgggagagtcaatgtg
gagagaaaataa

DBGET integrated database retrieval system