KEGG   Bacillus subtilis PY79: U712_12100Help
Entry
U712_12100        CDS       T02937                                 

Definition
(GenBank) Uncharacterized protein YqgZ
  KO
K16509  regulatory protein spx
Organism
bsp  Bacillus subtilis PY79
Brite
KEGG Orthology (KO) [BR:bsp00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99973 Transcription
    U712_12100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ArsC Glutaredoxin DUF1687
Motif
Other DBs
NCBI-ProteinID: AHA78361
LinkDB All DBs
Position
complement(2381892..2382272)
Genome map
AA seq 126 aa AA seqDB search
MEQQLTFYSYPSCTSCRKTKHWLKAHQIEFNERHLFRETPTREELKYILSLTTEGIDEIL
ATRSQTFKNLNLNIEEITVNEVLELLIEKPKLLRRPILVDNKKLVIGYNPGELLKLSKKK
TVHQSA
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atggaacaacaattaactttttactcatatccaagctgcacgtcatgccgaaaaacaaaa
cattggcttaaagcacatcaaattgaatttaacgaacggcacttattcagagaaaccccg
acaagagaagaattaaagtacattttatcgttaacgacagaaggaattgatgaaattttg
gcgacaagaagccagactttcaaaaatttaaatttaaacattgaagaaatcacggtaaat
gaggtgctggaacttttaatcgagaagccgaagcttttgcgacgcccgattctagtagac
aacaaaaagctggtgattggttataacccgggagaactgttgaagttatcgaagaagaaa
acggttcatcaatctgcatga

DBGET integrated database retrieval system