KEGG   Bacillus subtilis PY79: U712_12210Help
Entry
U712_12210        CDS       T02937                                 

Definition
(GenBank) putative ABC transporter permease protein yqgH
  KO
K02037  phosphate transport system permease protein
Organism
bsp  Bacillus subtilis PY79
Pathway
bsp02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsp00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    U712_12210
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsp02000]
    U712_12210
Transporters [BR:bsp02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    U712_12210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 DUF4064
Motif
Other DBs
NCBI-ProteinID: AHA78383
LinkDB All DBs
Position
complement(2397583..2398512)
Genome map
AA seq 309 aa AA seqDB search
MINNRENMSVSERLISSRQNRQLDEVRGRMIVTACALIMIAASVAITIFLGVKGLQSFLV
NGVSPIEFLTSLNWNPTDSDPKYGVLPFIFGSFAVTILSALIAAPLGIAGAIFMTEIAPN
WGKKVLQPVIELLVGIPSVVYGFIGLTVLVPFIAQFKSSGTGHSLLAGTIVLSVMILPTI
TSISADAMASLPKSLREGSYALGATRWQTIRKVLVPAAFPTLMTAVVLGMARAFGEALAV
QMVIGNTRVLPESPFDTAGTLTTIITLNMGHTTYGSVENNTLWSMGLVLLVMSFLFILLI
RYLSSRRKV
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgataaacaatagagaaaatatgtctgtgagcgagcgcttaatcagctctaggcaaaat
cggcaattggatgaagttcggggaagaatgatagtcacagcttgtgcactgattatgatt
gcggcatctgttgcgattaccattttcctcggcgttaaggggctgcaatcttttcttgta
aatggtgtaagcccaattgaattcttaacgagcttaaattggaatcctacagatagtgat
ccgaaatacggagtgctgccatttatttttggctcatttgcagtaacgattctttctgct
ctaatcgctgcgccgcttggcattgcaggtgcgatttttatgacagagattgccccgaat
tggggaaagaaagtgctgcagccggtgattgagcttttagtcggtattccatctgttgtt
tatggattcataggtcttacagtattggtgccgtttatcgcccagttcaaatcgagcgga
acagggcacagtttattggcgggaacgattgtcctttccgtcatgattctgccgacgatc
acatcgatttctgctgatgcaatggcttctcttccgaagagtttacgagagggttcttac
gcgcttggtgccacaagatggcagacgatcagaaaagtacttgtgcctgcagcttttcca
acattgatgacagctgttgtgttaggcatggctcgggcgttcggtgaagctttggctgtt
cagatggtcattggaaatacaagagtattgccggaaagcccgtttgacactgcgggaacg
ctgacaacgatcatcacgctgaatatgggccacaccacatacggaagtgttgaaaacaat
acgctgtggtcaatggggcttgtgcttctggtgatgtcattcttgttcatcctgcttatt
cgctacttgtcatctaggaggaaagtgtaa

DBGET integrated database retrieval system