KEGG   Bacillus subtilis PY79: U712_12325Help
Entry
U712_12325        CDS       T02937                                 

Definition
(GenBank) DNA primase
  KO
K02316  DNA primase [EC:2.7.7.101]
Organism
bsp  Bacillus subtilis PY79
Pathway
bsp03030  DNA replication
Brite
KEGG Orthology (KO) [BR:bsp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    U712_12325
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bsp03032]
    U712_12325
Enzymes [BR:bsp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.101  DNA primase DnaG
     U712_12325
DNA replication proteins [BR:bsp03032]
 Prokaryotic type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    U712_12325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_N zf-CHC2 Toprim_2 Toprim_4 DnaB_bind Toprim_3 Toprim DnaB DUF3854 RecX PepX_N
Motif
Other DBs
NCBI-ProteinID: AHA78406
LinkDB All DBs
Structure
PDB: 

Position
complement(2419382..2421193)
Genome map
AA seq 603 aa AA seqDB search
MGNRIPDEIVDQVQKSADIVEVIGDYVQLKKQGRNYFGLCPFHGESTPSFSVSPDKQIFH
CFGCGAGGNVFSFLRQMEGYSFAESVSHLADKYQIDFPDDITVHSGARPESSGEQKMAEA
HELLKKFYHHLLINTKEGQEALDYLLSRGFTKELINEFQIGYALDSWDFITKFLVKRGFS
EAQMEKAGLLIRREDGSGYFDRFRNRVMFPIHDHHGAVVAFSGRALGSQQPKYMNSPETP
LFHKSKLLYNFYKARLHIRKQERAVLFEGFADVISAVSSDVKESIATMGTSLTDDHVKIL
RRNVEEIILCYDSDKAGYEATLKASELLQKKGCKVRVAMIPDGLDPDDYIKKFGGEKFKN
DIIDASVTVMAFKMQYFRKGKNLSDEGDRLAYIKDVLKEISTLSGSLEQEVYVKQLASEF
SLSQESLTEQLSVFSKQNKPADNSGETKTRRAHLTTKARQKRLRPAYENAERLLLAHMLR
DRSVIKKVIDRVGFQFNIDEHRALAAYLYAFYEEGAELTPQHLMARVTDDHISQLLSDIL
MLQVNQELSEAELSDYVKKVLNQRNWSMIKEKEAERAEAERQKDFLRAASLAQEIVTLNR
SLK
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatcggataccagatgaaattgtggatcaggtgcaaaagtcggcagatatcgtt
gaagtcataggtgattatgttcaattaaagaagcaaggccgaaactactttggactctgt
ccttttcatggagaaagcacaccttcgttttccgtatcgcccgacaaacagatttttcat
tgctttggctgcggagcgggcggcaatgttttctcttttttaaggcagatggaaggctat
tcttttgccgagtcggtttctcaccttgctgacaaataccaaattgattttccagatgat
ataacagtccattccggagcccggccagagtcttctggagaacaaaaaatggctgaggca
catgagctcctgaagaaattttaccatcatttgttaataaatacaaaagaaggtcaagag
gcactggattatctgctttctaggggctttacgaaagagctgattaatgaatttcagatt
ggctatgctcttgattcttgggactttatcacgaaattccttgtaaagaggggatttagt
gaggcgcaaatggaaaaagcgggtctcctgatcagacgcgaagacggaagcggatatttc
gaccgcttcagaaaccgtgtcatgtttccgatccatgatcatcacggggctgttgttgct
ttctcaggcagggctcttggcagccagcagcctaagtatatgaacagtcctgaaaccccg
ctctttcataaaagcaaactgctttacaatttttataaggcccgccttcatatcagaaag
caggaaagagcagtcttatttgaagggtttgctgatgtcatatcggccgtaagctcggat
gtaaaggaaagcatagccacgatgggaacgtctcttacagatgatcatgtcaagatcctg
agaagaaacgtcgaagaaatcattctttgctatgactctgataaagccggttatgaagcc
accttaaaagcttcggagcttctgcaaaaaaaaggctgcaaagtcagagttgcaatgatt
cctgacggattggaccctgatgattacatcaaaaaattcggcggggaaaaatttaaaaac
gacattattgacgcaagtgtcaccgtaatggcgttcaaaatgcaatatttccgaaaagga
aagaacctgtccgatgaaggcgaccgcctagcttacattaaagacgtactgaaagaaatc
agcacgctttcagggtctctagagcaggaagtctatgtaaagcagcttgcttcagagttt
tcgctttcacaggagtctttaactgagcagctgtctgttttcagcaagcaaaacaaacct
gctgacaatagcggtgaaactaaaacgcggcgagcgcatctgacgacaaaagcaaggcaa
aaacgtttgcgtccggcgtatgaaaatgcagaaaggctgttactcgctcacatgcttcga
gatcggagcgtcatcaaaaaagtgattgaccgggtagggtttcaatttaatattgatgag
caccgggcattagccgcttatctttatgctttttatgaagagggagccgagctgacgcct
cagcatctgatggccagggtgacggatgatcatataagccagctcttgtccgatatatta
atgcttcaggttaatcaagagcttagcgaagccgagttatcagattatgtaaaaaaagtg
ttgaatcaaagaaattggtcaatgataaaagaaaaagaggcggaaagagccgaagcagaa
aggcaaaaagattttttaagagctgcttctttggctcaagaaatcgttacattgaaccga
tctttaaaataa

DBGET integrated database retrieval system