KEGG   Bacillus subtilis PY79: U712_13500Help
Entry
U712_13500        CDS       T02937                                 

Definition
(GenBank) putative glutamine ABC transporter permease protein glnP
  KO
K10040  aspartate/glutamate/glutamine transport system permease protein
Organism
bsp  Bacillus subtilis PY79
Pathway
bsp02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsp00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    U712_13500
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsp02000]
    U712_13500
Transporters [BR:bsp02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Aspartate/glutamate/glutamine transporter
    U712_13500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AHA78638
LinkDB All DBs
Position
2622511..2623167
Genome map
AA seq 218 aa AA seqDB search
MDFIGAYSQEHLAFLWDGFLVTLYVAFISIILSFFFGLIAGTLRYAKVPVLSQLIAVLVE
TIRNLPLLLIIFFTFFALPEIGIKLEITAAAITALTIFESAMLSEIIRSGLKSIDKGQIE
AARSSGLSYTQTLFFIVMPQALRRMVPPIVSQFISLLKDTSLAVVIALPELIHNAQIING
QSADGSYFFPIFLLAALMYFAVNYSLSLAARRLEVRQT
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
ttggatttcatcggtgcttattcacaggagcatttagcgtttttatgggatggctttctc
gtcaccttgtacgttgctttcatctccatcattctgagctttttcttcggtttaatcgca
ggcaccctgcgttatgcgaaagttcccgttctttctcaattgattgcagttctcgttgaa
acgatcagaaacctccccttgctgttaattattttctttacgttttttgcccttccggaa
attgggattaagcttgaaattacagctgctgcaattacagcactaacgatttttgaatcc
gctatgctatctgaaattatccgaagcggactgaaatcaattgacaaaggacaaattgaa
gcggcgcgctcctccgggctgagctatacacagaccctgttctttatcgttatgccgcaa
gcgcttcgccgcatggttccgcccatcgtaagccagtttatttctttattaaaagataca
tcgctcgctgttgtgatcgccctgcctgaactgattcacaacgcgcaaattattaacggc
caaagcgctgacggcagttattttttcccgatctttttacttgcggcccttatgtatttc
gcagtcaactacagcctttcactcgcagcaagacgcctcgaggtccggcaaacatag

DBGET integrated database retrieval system