KEGG   Bacillus subtilis PY79: U712_14560Help
Entry
U712_14560        CDS       T02937                                 

Definition
(GenBank) L-cystine transport system permease protein tcyL
  KO
K16958  L-cystine transport system permease protein
Organism
bsp  Bacillus subtilis PY79
Pathway
bsp02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsp00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    U712_14560
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsp02000]
    U712_14560
Transporters [BR:bsp02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   L-Cystine transporter
    U712_14560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 HupE_UreJ_2 LapA_dom
Motif
Other DBs
NCBI-ProteinID: AHA78850
LinkDB All DBs
Position
complement(2823713..2824432)
Genome map
AA seq 239 aa AA seqDB search
MEKAFDMNMIGDFVPTLTAYLPVTLYILTLSLLFGFVLGLFLALPRIYNIPIVNQLAKVY
ISFFRGTPIMVQLFIVFYGIPALTGLIGIDTSKMDPFYAAVATYALSNAAAAAEIIRAGV
GSVDKGQTEAAYSIGLSGSQAFRRIVLPQALVQAFPNMGNMVISSLKDTSLAFSIGVMDM
SGRGQTLITSSNHSLEVYIALSIVYYAVAVLFEWFFRVAEKRIKKNQTRIVTVFDMNIH
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagcgtttgatatgaacatgattggagattttgtgccgacgttaaccgcttat
ttaccggttacattatacattttaacactgtccttgcttttcggttttgtattaggactc
tttctggcactgccccgcatctataatattccaattgtaaatcaattggcaaaagtgtat
atctcgtttttcaggggaacgcctatcatggtgcagcttttcatcgtgttttacgggatc
ccggcgcttacggggcttatcgggattgatacatcaaaaatggacccgttttatgctgct
gtcgcaacctacgcgttaagcaatgcagcggcagccgcagaaatcattcgagcgggggtg
ggcagtgtagataaaggccaaacggaagcggcgtacagtattggcttaagcggtagtcag
gccttcaggcgaatcgttctgccccaggcacttgtccaggcgtttccgaatatgggaaac
atggtgatcagttctttaaaagatacgtctctagccttttcaataggtgttatggatatg
tccggaaggggccaaacactgattacctcaagcaaccattctcttgaagtttacattgcg
ctatcgattgtttattatgctgtagcggttttattcgaatggttctttcgagtggcagaa
aaacgaatcaagaagaatcaaacaaggattgttactgtttttgacatgaacatacattga

DBGET integrated database retrieval system