KEGG   Bacillus subtilis PY79: U712_15830Help
Entry
U712_15830        CDS       T02937                                 

Definition
(GenBank) Uncharacterized protein yueI
Organism
bsp  Bacillus subtilis PY79
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1694
Motif
Other DBs
NCBI-ProteinID: AHA79103
LinkDB All DBs
Structure
PDB: 

Position
complement(3079393..3079791)
Genome map
AA seq 132 aa AA seqDB search
MSEDKMDLYLQQGMYGPLETKPDERHLFLGSLRERVVLALTKGQVLRSKPYKEAEHELKN
SHNVTLLINGELQYQSYSSYIQMASRYGVPFKIVSDLQFHTPLGIVIAADIAVNRELIYI
QDDIYNRSVLKS
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
ttgagtgaagataaaatggatctctatttgcagcaaggaatgtatgggcctttggagaca
aagcctgacgagcgccatttgtttttaggctctttaagagaaagagtcgttttggcactg
acgaaaggacaggtgcttagaagcaaaccgtataaagaggcagagcacgagctgaaaaac
agccataacgtcacccttttgattaatggagagcttcagtatcagtcttactcttcttat
atccaaatggcgagccggtacggagtgcctttcaagattgtatctgatctccagtttcat
acgcccttaggcatcgtcattgcggctgatatcgctgtgaatcgtgaattgatatatatt
caggacgacatttataatcggtcagtactgaaatcgtaa

DBGET integrated database retrieval system