KEGG   Bacillus subtilis PY79: U712_15905Help
Entry
U712_15905        CDS       T02937                                 

Definition
(GenBank) Uncharacterized protein YukF
Organism
bsp  Bacillus subtilis PY79
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_30 GGDEF_2 CodY HTH_8
Motif
Other DBs
NCBI-ProteinID: AHA79118
LinkDB All DBs
Position
3094854..3096077
Genome map
AA seq 407 aa AA seqDB search
MPNDPFKYSFDRLEDVADHISDVLRCPITIEDVNHKLLAYSTHSDCTDPARTSTIIGRRV
PEKVINKLWKDGTIPALLKTDQPIRVKQIDEVGLSNRVAISIWKNKQVLGFIWALEIQKT
LSDEDLLTLQMAAKAVKNKLLKLQIRKTKNEERSQEFFWKMLTGHIHQEDDMADGFHKLG
MAAPSEFSVMIIRINGELTEKIEQQLQYLQETTQQVYVLLATVDSNELIILTSPKTDHPF
QDLKQFALSTQKQLKERYKIEDVSIAFGGIYNSISFVSRSYQEALSVLKTKERFAEETKH
LFSFSELGIYQYLDVLNEKRKQAGHYNYSLSKLEQYDRDHQSNMVETLERFIEADSNVNT
ASKLLNIHVNTLNYRLKRISQIAEIDLKNVNQKFTIYLDIKLRHMDL
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgccgaatgatccgtttaaatatagttttgacagacttgaagatgtggctgatcatatc
agcgacgttctgcggtgcccgatcaccatagaggatgttaaccacaagctgcttgcctac
agtacacacagcgactgcacagaccctgcccggacgtctaccattattggcagaagggta
ccggagaaggtgattaacaagctgtggaaagacgggacaattcctgctctcttaaaaacg
gaccagccgatcagagtcaagcaaatcgatgaagtcgggctgagcaatcgcgtcgctatt
tcgatttggaaaaacaagcaagtacttggcttcatatgggcgcttgagatccaaaaaaca
ttgtccgatgaagatctgctgacattgcaaatggcagcaaaagcagtgaaaaacaagctt
ctcaaacttcaaatcagaaaaacgaaaaatgaagaacgcagccaagaatttttctggaaa
atgctgaccggacacatccatcaggaggatgatatggcggatgggttccataagcttgga
atggccgctccttcagagttttccgttatgatcatccgcataaatggcgagctgactgaa
aaaatcgaacagcagctgcaatatttacaggaaacgacccagcaggtttacgtgctgctg
gcgaccgtagattccaatgaacttattatattaacctcacccaaaacagatcatcctttt
caagatttaaaacagtttgctttaagtacgcaaaaacagctgaaggagcggtataaaata
gaagacgtttctatcgcttttggcggaatatacaactctatttcttttgtctcccgctcc
tatcaggaagcattgtccgtcttaaaaacgaaggaacggttcgctgaagagaccaaacat
cttttcagcttttctgagttaggcatttatcaatacttagatgtcttaaatgaaaaacgg
aaacaggcgggccattataattactcgctttccaaactggaacaatatgaccgggatcac
cagtcaaatatggtagagacgctagagcgctttattgaagcggacagcaacgtgaatacc
gcttccaagctgttaaatatacacgttaatacgttgaattaccgactcaagcggatcagc
cagatcgctgaaattgatttgaaaaatgtgaatcaaaaattcaccatctatttagatatc
aaacttcggcacatggatttgtga

DBGET integrated database retrieval system