KEGG   Bacillus subtilis PY79: U712_16455Help
Entry
U712_16455        CDS       T02937                                 

Definition
(GenBank) Uncharacterized protein yusU
Organism
bsp  Bacillus subtilis PY79
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2573 DUF3106
Motif
Other DBs
NCBI-ProteinID: AHA79227
LinkDB All DBs
Position
complement(3196654..3196941)
Genome map
AA seq 95 aa AA seqDB search
MRKLLAVFSKGRWKMEQKLQEQLDGLLEKYTELLLGETNDELKEEVKQWILYTHIAKSMP
PLAKHWNATYPDAKQGIKEIIQHIKELNEAHRNKQ
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
ttgagaaagctccttgctgttttttcgaaaggaagatggaaaatggaacaaaaacttcag
gagcagcttgatggattgctggagaagtatactgagcttctgcttggtgaaacaaacgat
gagctaaaagaagaagtgaagcaatggattttgtacacccatatagccaaaagcatgcct
ccgctcgctaagcattggaatgcgacataccccgacgcgaagcagggcattaaagagatc
attcagcatattaaggaattaaatgaagcgcatcgaaacaaacaatag

DBGET integrated database retrieval system