KEGG   Bacillus subtilis PY79: U712_16920Help
Entry
U712_16920        CDS       T02937                                 

Definition
(GenBank) Glycine betaine/carnitine/choline transport system permease protein opuCB
  KO
K05846  osmoprotectant transport system permease protein
Organism
bsp  Bacillus subtilis PY79
Pathway
bsp02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsp00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    U712_16920
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsp02000]
    U712_16920
Transporters [BR:bsp02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Osmoprotectant transporter
    U712_16920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 ABC2_membrane_3
Motif
Other DBs
NCBI-ProteinID: AHA79318
LinkDB All DBs
Position
complement(3287038..3287691)
Genome map
AA seq 217 aa AA seqDB search
MNQMMTFLQTNGGELLYKTGEHLYISLIAVVLGIIVAVPLGVALTRMKKGAGAVIGFVNI
VQTLPSLAILAFFIPLLGVGKVPAIVALFFYSVLPILRNTYTGIKGVNKNLLESGKGIGM
TGWEQIRLVEIPLAIPIIMAGIRTSTIYLIGWATLASFIGGGGLGDYIFIGLNLYQPEYI
IGGAVPVTILAIIIDYVLAVTERKVTPKGLQGMKEVS
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaaatgatgacttttttgcaaacgaacggcggagagctgctgtataaaacagga
gagcatttatatatttcactcatagccgttgtattgggcattatcgttgcagtgccgctc
ggcgttgctcttaccagaatgaaaaaaggcgcaggtgcggttatcggtttcgtaaacatt
gtgcaaaccctgccgagtctggcgattttagccttttttattccgcttctcggcgtagga
aaagtgcctgcgattgtcgctttatttttctattcggtactgccgatcctgcgcaatacg
tataccggcattaaaggtgtaaataaaaacctcctggaatcggggaaaggaattggcatg
accggctgggagcagattcggctcgttgaaatcccgctggcgattcccatcatcatggcg
gggatccgcacatcaacgatctacctaattggctgggcgacacttgcgtcgtttatcggg
ggaggcggcctcggggactatatttttatcggactgaacctataccagcctgaatatatc
attggcggtgccgtgcctgtcacaattctggcaattattattgattatgttctggctgtg
acagaacgaaaggtgacgccgaaaggcttgcaagggatgaaggaagtatcgtaa

DBGET integrated database retrieval system