KEGG   Bacillus subtilis PY79: U712_17455Help
Entry
U712_17455        CDS       T02937                                 

Definition
(GenBank) Histidine biosynthesis bifunctional protein HisIE
  KO
K11755  phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase [EC:3.6.1.31 3.5.4.19]
Organism
bsp  Bacillus subtilis PY79
Pathway
bsp00340  Histidine metabolism
bsp01100  Metabolic pathways
bsp01110  Biosynthesis of secondary metabolites
bsp01230  Biosynthesis of amino acids
Module
bsp_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:bsp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    U712_17455
Enzymes [BR:bsp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     U712_17455
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     U712_17455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH PRA-PH MazG
Motif
Other DBs
NCBI-ProteinID: AHA79423
LinkDB All DBs
Position
complement(3400790..3401419)
Genome map
AA seq 209 aa AA seqDB search
MKQADELRFNEDGLIPAIVQDAASKEVLTLAYMNKESYEKTLETKETWFYSRSRQALWHK
GETSGNTQAVKGIRYDCDQDALLVLVEPSGPACHTGSYSCFTKEQTEEQAADRFGIMNEL
ERVIAERQAEMPEGAYTTYLFREGVDKILKKVGEEASEVIIAAKNRDHEELKWEAADLLY
HLLVLLREQSLPLDDVLDVLKKRHSEIEE
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaggcagatgaactgcgttttaacgaggacggattaattcctgctatcgtgcag
gatgcggcaagcaaagaagtgctgacacttgcgtatatgaacaaggaatcgtacgaaaaa
acgctggaaacgaaggaaacatggttttacagccgctcacgccaagcgttatggcataaa
ggagaaacctcagggaacacgcaagccgtcaaaggtatccggtatgactgcgatcaagac
gcgctgctcgtactcgtagaaccgtcaggcccggcatgccacactggcagctacagctgt
tttacaaaggaacaaacagaagaacaggccgcggaccgattcggcatcatgaacgaactg
gagcgggtgatcgcggaacgccaagcggaaatgcctgaaggagcttacaccacgtacctc
ttccgtgaaggcgtcgataagattttgaaaaaagtcggagaagaagcatccgaagtcatc
atcgccgcgaaaaaccgggatcatgaggaactcaaatgggaagcggcagacctgctgtat
cacctgcttgtcctgctcagagaacaatccctgccgctggatgatgtgcttgacgtattg
aaaaaacgccattctgagattgaagagtaa

DBGET integrated database retrieval system