KEGG   Bacillus subtilis PY79: U712_17760Help
Entry
U712_17760        CDS       T02937                                 

Definition
(GenBank) Uncharacterized protein yvyG
Organism
bsp  Bacillus subtilis PY79
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FlgN LPD5 YkuI_C DUF3531
Motif
Other DBs
NCBI-ProteinID: AHA79484
LinkDB All DBs
Position
complement(3457641..3458123)
Genome map
AA seq 160 aa AA seqDB search
MSAKAIIEQLKRLCVLHEHLLTLSEEKTEALKAGKTKELSNILTKEQKYIQAITQTEDDR
IKTTSAFLGYSENNTISACIAKTSGSEKEELEQLYESLSQVLGRLKKVNEMNRQLTRDAL
QFISISYDMLVPKENNFNYSKSIKAELPKSSKMKLFDSKA
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcgaaggcaattattgaacaattgaagcgactttgcgttctgcatgagcacctg
ctcacgctgtctgaagaaaagacggaagcgctcaaagccggcaaaacaaaagagctttct
aacattttgacaaaagagcaaaaatatattcaagcaatcacgcagacagaagatgaccgg
atcaaaacaacttcggcctttctcggatatagcgaaaataatactatttccgcatgtatc
gccaaaacctcaggcagtgaaaaggaagagctggaacaactatacgaatctctttctcaa
gttctcggacgtctgaaaaaagtaaatgagatgaataggcagctgacaagagacgcgctg
caattcatctctatttcgtacgatatgctggttcctaaggaaaataacttcaattacagc
aaatcaattaaagctgagctgccgaaaagtagcaaaatgaaactgtttgattcaaaagct
tag

DBGET integrated database retrieval system