KEGG   Bacillus subtilis PY79: U712_17780Help
Entry
U712_17780        CDS       T02937                                 

Definition
(GenBank) ComF operon protein 2
  KO
K02241  competence protein ComFB
Organism
bsp  Bacillus subtilis PY79
Brite
KEGG Orthology (KO) [BR:bsp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bsp02044]
    U712_17780
Secretion system [BR:bsp02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) core components
   U712_17780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ComFB
Motif
Other DBs
NCBI-ProteinID: AHA79488
LinkDB All DBs
Structure
PDB: 

Position
complement(3459665..3459961)
Genome map
AA seq 98 aa AA seqDB search
MLVNSKEIVMKELLDRYMDQLHMACTCQVCQNDVLALSLNKVSPSYVTDFKKIAYTKAEL
VDKQKNTAMLVILAESAAVVSESPSDLCQTKQEEAFIN
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atgcttgtcaattcaaaagaaatcgtaatgaaagaactgctcgaccgatatatggaccag
cttcatatggcctgtacttgccaagtatgccaaaacgatgtattggcactttctttaaac
aaagtgagtccatcctacgttactgattttaaaaagatcgcatatacgaaagctgagctg
gtagataaacaaaaaaacacagcaatgcttgtcattttggctgaatctgctgcagtagtt
tcagagagtccaagcgatttatgtcaaacgaagcaggaggaggcattcataaactga

DBGET integrated database retrieval system