KEGG   Bacillus subtilis PY79: U712_18085Help
Entry
U712_18085        CDS       T02937                                 

Definition
(GenBank) HTH-type transcriptional regulator AlsR
Organism
bsp  Bacillus subtilis PY79
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1 HTH_20 HTH_24
Motif
Other DBs
NCBI-ProteinID: AHA79548
LinkDB All DBs
Position
3529352..3530260
Genome map
AA seq 302 aa AA seqDB search
MELRHLQYFIAVAEELHFGKAARRLNMTQPPLSQQIKQLEEEVGVTLLKRTKRFVELTAA
GEIFLNHCRMALMQIGQGIELAQRTARGEQGLLVIGFVGSATYEFLPPIVREYRKKFPSV
KIELREISSSRQQEELLKGNIDIGILHPPLQHTALHIETAQSSPCVLALPKQHPLTSKES
ITIEDLRDEPIITVAKEAWPTLYMDFIQFCEQAGFRPNIVQEATEYQMVIGLVSAGIGMT
FVPSSAKKLFNLDVTYRKMDQIQLNAEWVIAYRKDNHNPLIKHFIHISNCQQTRTKESDA
GT
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggagcttcgccatcttcaatactttatcgcagtagccgaagagcttcatttcggaaag
gctgcccggcggctgaacatgacgcagcctcctctcagccagcagatcaaacagctggag
gaagaagtcggagttacgcttctgaaaaggacaaaacgatttgtcgagcttaccgcagca
ggagaaatctttttaaatcattgccgcatggcattgatgcaaatcggacaaggaattgaa
ctggcacagcggacggcccgcggcgagcaaggccttctcgtaatcggttttgtcggatca
gctacatatgaatttctgccgccgattgtccgggaatatcgtaaaaaattcccatctgtg
aaaatagaactgcgtgaaatatcctcgtctaggcagcaggaggagctactaaagggcaac
attgatattggtatacttcatcctcccttacagcatacagctttacatatcgaaaccgcc
caaagcagcccttgtgttttagctttgcctaagcaacacccattgacttctaaggaatca
attacgattgaggatttaagagatgaaccaattattactgttgctaaagaagcatggcct
actctatacatggattttattcagttctgtgaacaagcgggcttcagacccaacattgtc
caggaagccacagaatatcaaatggtgattggtttagtcagtgccggaattggtatgaca
tttgttccttcctcggccaaaaaattatttaatttggatgttacttatcgaaaaatggac
caaatacagcttaatgcagaatgggttatcgcttaccgcaaagacaatcataatccgctt
ataaagcattttattcatatttcaaattgtcagcagacaagaactaaagagagtgatgca
ggtacatga

DBGET integrated database retrieval system