KEGG   Bacillus subtilis PY79: U712_18120Help
Entry
U712_18120        CDS       T02937                                 

Definition
(GenBank) Putative gamma-glutamyltransferase ywrD
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
bsp  Bacillus subtilis PY79
Pathway
bsp00430  Taurine and hypotaurine metabolism
bsp00460  Cyanoamino acid metabolism
bsp00480  Glutathione metabolism
bsp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    U712_18120
   00460 Cyanoamino acid metabolism
    U712_18120
   00480 Glutathione metabolism
    U712_18120
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bsp01002]
    U712_18120
Enzymes [BR:bsp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     U712_18120
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     U712_18120
Peptidases and inhibitors [BR:bsp01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   U712_18120
CD molecules [BR:bsp04090]
 Proteins
  U712_18120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: AHA79555
LinkDB All DBs
Position
complement(3536988..3538565)
Genome map
AA seq 525 aa AA seqDB search
MNKSVIGTKQMVVSPHYLASQAGNRILDKGGNAFDAAVAVSACLAVVYPHMTGLGGDSFW
LTFHQETKAVKVYNGSGRSGKNVTRDVYKGKSAIPLRGIDSAITVPGMVDSWDAVLKEYG
RLSLADVLEPARDYAQNGFPVSADQCRHTEKNIELLASTPYTADIFTRRGKAPVPGERFV
QKELADSLNLIAEKGRSAFYEGDLAQRIVSHLQNNGSYMTIDDFKAHRGEWAAPVSSDYR
GYSVYQAPPNSQGFTGLLTLNILENYDFTQIEHGSFEYYHVLVEALKKSFLDRDAVLTDP
AFADIPLERLLDKRYAKQLAEEIGYLAIPAESRPVGSDTAYAAVIDADGNAVSFIQSLYF
EFGSAVTAGDTGILLQNRGSFFSLDENHVNTLEPRKRTFHTLMPAMVCKGGKPKILYGTQ
GGEGQPQTQTAIITRMLDYGMHPQQAISEPRWVWGRTWGEEYEGLRVEGRFTDKTIQKLK
DSGHLVEVVGDYDPLMGQAAAIKVDEEGFLQGGADPRGDGAAVGI
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaatctgtcatcggtacaaagcaaatggtcgtcagtccgcattatctcgcttct
caagccggaaaccgcatactggataagggaggcaacgcgtttgacgccgctgttgcggtg
agtgcttgtcttgcggttgtgtacccgcatatgaccggacttggcggggattccttttgg
ctgacctttcaccaggaaacaaaggcagtaaaagtctacaatggcagcggccgttcagga
aaaaacgtaacgagagatgtatataagggaaaaagcgcgattccgctgcggggaattgac
agtgctattaccgtgccgggaatggttgatagctgggatgcggtcctgaaggagtacggg
cgtctgtctcttgcagatgtattggagcccgcacgcgattatgcccaaaatgggtttcct
gtatcagctgatcagtgtcgtcacacagaaaagaatattgaactgctggcttccacgcct
tacacggctgacatcttcacgagaaggggcaaagcacctgtcccgggagagcggtttgtg
caaaaagagcttgcagacagtctgaacttgattgctgaaaaaggaagaagcgcattttat
gaaggagatctcgctcagcggattgtctcacatttacagaataacggcagttacatgaca
atcgatgattttaaagcgcatcggggtgagtgggcagcgcctgtatcaagtgattatcga
ggatacagtgtgtatcaggcgccgccgaattctcagggatttaccggtttattaacactg
aacattttggaaaactatgatttcacccaaatcgaacacggttcatttgagtattatcac
gtgcttgtggaggcattgaaaaagagttttctagatcgggatgccgtcctgactgatccg
gcgtttgcagacattccgcttgaaaggcttttggacaaacgttatgcaaaacaattggca
gaagaaatcggctatctcgcaataccggcagaaagcaggccggtgggaagtgatacggca
tatgcggccgtaatcgatgcggatggcaacgcagtgtcattcattcaaagcctgtacttt
gaatttggctcggcagtcactgccggtgatacaggcatattactgcaaaaccgcggatcg
tttttctcactggatgaaaatcatgtcaacacgcttgaaccgagaaagcgcaccttccat
acgttgatgccggctatggtctgtaaaggcggaaagccaaaaattctgtacggcacacaa
ggcggcgaaggccagccgcagacccagacggccatcattacccgaatgctggactacgga
atgcatccacagcaggcaatcagcgaaccgcgctgggtatggggcagaacgtggggagag
gaatacgaaggtctcagagtcgagggcagattcacagacaaaacaatccaaaaactgaaa
gacagcgggcatctcgtggaggttgtcggtgactatgatccgctgatgggacaagcggct
gcaatcaaagttgatgaagaaggctttctccaaggcggagccgatcctcggggagacgga
gcggctgtggggatttaa

DBGET integrated database retrieval system