KEGG   Bacillus subtilis PY79: U712_18995
Entry
U712_18995        CDS       T02937                                 

Definition
(GenBank) putative aspartate aminotransferase
  KO
K19549  bacilysin biosynthesis transaminase BacF [EC:2.6.1.-]
Organism
bsp  Bacillus subtilis PY79
Pathway
bsp00998  Biosynthesis of various secondary metabolites - part 2
bsp01100  Metabolic pathways
bsp01110  Biosynthesis of secondary metabolites
Module
bsp_M00787  Bacilysin biosynthesis, prephenate => bacilysin
Brite
KEGG Orthology (KO) [BR:bsp00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    U712_18995
Enzymes [BR:bsp01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.-  
     U712_18995
SSDB
Motif
Pfam: Aminotran_1_2 Alliinase_C Cys_Met_Meta_PP
Other DBs
NCBI-ProteinID: AHA79729
LinkDB
Position
complement(3686142..3687341)
AA seq 399 aa
MEITPSDVIKTLPRQEFSLVFQKVKEMEKTGAHIINLGQGNPDLPTPPHIVEALREASLN
PSFHGYGPFRGYPFLKEAIAAFYKREYGVTINPETEVALFGGGKAGLYVLTQCLLNPGDI
ALVPNPGYPEYLSGITMARAELYEMPLYEENGYLPDFEKIDPAVLEKAKLMFLNYPNNPT
GAVADAAFYAKAAAFAKEHNIHLIHDFAYGAFEFDQKPASFLEAEDAKTVGAELYSFSKT
FNMAGWRMAFAVGNEKIIQAVNEFQDHVFVGMFGGLQQAASAALSGDPEHTESLKRIYKE
RIDFFTALCEKELGWKMEKPKGTFYVWAEIPNTFETSHQFSDYLLEHAHVVVTPGEIFGS
NGKRHVRISMVSKQEDLREFVTRIQKLNLPFGSLQETSR
NT seq 1200 nt   +upstreamnt  +downstreamnt
atggaaataacaccgtccgatgtcatcaagacacttccaaggcaggagttttctctcgtt
tttcaaaaggtaaaggaaatggaaaaaacgggagcccatatcattaatctcggacagggg
aaccctgaccttcccactccgccgcatattgtcgaggctttgcgggaggcttctctgaat
ccttcgtttcatggatacggccctttcaggggctatccttttttaaaggaagcgatcgcc
gctttctataaaagggaatacggagtgacaatcaatcctgaaacggaagtcgcgcttttc
ggaggcgggaaagccggattgtatgtgctgacacaatgcctgctcaatccgggagacatc
gctttagtcccgaatccaggctatcctgaatatttatcagggattacgatggcgcgagct
gagctttacgaaatgccgctgtatgaagaaaatggctatctgccggattttgaaaagatt
gatccagccgtgctggaaaaagcgaagcttatgtttttaaactatccgaacaaccccact
ggagctgtggctgatgcggctttttatgcaaaagctgctgcttttgcgaaagagcataac
atccatttgattcatgattttgcatacggggcgtttgaattcgatcaaaaaccggccagc
tttcttgaggcagaggatgccaaaactgtcggagcagagctttattcattttcaaaaaca
tttaacatggccggctggagaatggcgtttgcggttgggaacgaaaaaatcattcaggcc
gtcaatgaatttcaggatcatgtatttgtcggcatgttcggcgggctgcagcaggcagcg
agtgcggcgctttctggagatccggagcatacggaatcgttgaaacgaatttataaggaa
cgaattgacttttttacggcgctttgtgaaaaggaactgggctggaagatggaaaagcca
aaaggaaccttttacgtatgggctgaaattccgaatacgtttgagacatctcaccaattt
tccgattacttgctggagcatgcccatgtcgtagtcacaccgggcgaaatttttggaagc
aacggaaaaaggcatgtcagaatctcaatggtgtcgaagcaggaggatctgcgggaattt
gtcacgcggattcaaaagctgaacctgccgttcgggtcattacaagaaacatcccgctaa

DBGET integrated database retrieval system