KEGG   Bacillus subtilis PY79: U712_19975Help
Entry
U712_19975        CDS       T02937                                 

Definition
(GenBank) putative amino-acid permease protein yxeN
  KO
K16962  putative S-methylcysteine transport system permease protein
Organism
bsp  Bacillus subtilis PY79
Pathway
bsp02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsp00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    U712_19975
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsp02000]
    U712_19975
Transporters [BR:bsp02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Putative S-methylcysteine transporter
    U712_19975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AHA79922
LinkDB All DBs
Position
complement(3876643..3877317)
Genome map
AA seq 224 aa AA seqDB search
MNTIDWEFMISAFPTLIQALPITLFMAIAAMIFAIIGGLILALITKNKIPVLHQLSKLYI
SFFRGVPTLVQLFLIYYGLPQLFPEMSKMTALTAAIIGLSLKNAAYLAEIFRAALNSVDD
GQLEACLSVGMTKFQAYRRIILPQAIRNAIPATGNTFIGLLKETSLAFTLGVMEMFAQGK
MYASGNLKYFETYLAVAIVYWVLTIIYSILQDLFERAMSKPYRT
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgaacacgattgattgggaattcatgatatcagcgttcccgactttaattcaggccctt
ccgatcaccttgtttatggcaatagcagctatgatttttgccattatcggaggacttatt
ctcgcactcattacaaaaaacaaaattccagtgcttcatcagctgtcaaagctgtatata
tcctttttccgaggcgtgccgacacttgtacagctgttcttaatctattacgggctgccg
cagctatttccagagatgagcaaaatgacagctctcacagctgccatcatcgggttaagc
ttaaaaaacgcagcttatttggcagaaatcttccgggccgccctcaattctgttgatgac
gggcagctggaggcgtgcctgtctgtcggtatgacaaaatttcaggcatacagacggatt
attttgccgcaagcgatccgaaatgcgattccggcaacgggcaatacatttatcgggctc
ctgaaagaaacgtcactggcctttacattaggggtcatggagatgttcgcccaagggaag
atgtacgcttcaggaaacctcaaatattttgagacgtatttggcggttgcgatcgtctat
tgggttcttaccattatctacagcattttgcaggacttgtttgaacgtgccatgagcaag
ccataccggacttag

DBGET integrated database retrieval system