KEGG   Bacillus subtilis PY79: U712_20290Help
Entry
U712_20290        CDS       T02937                                 

Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bsp  Bacillus subtilis PY79
Brite
KEGG Orthology (KO) [BR:bsp00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    U712_20290
Enzymes [BR:bsp01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     U712_20290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 GIDA HI0933_like AlaDh_PNT_C Thi4 DAO FAD_oxidored NAD_binding_7 FAD_binding_3 NAD_binding_8 K_oxygenase Glutaredoxin Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AHA79985
LinkDB All DBs
Position
3937379..3938908
Genome map
AA seq 509 aa AA seqDB search
MVLDANIKAQLNQYMQLIENDIVLKVSAGEDDTSKDMLALVDELASMSSKISVEKAELNR
TPSFSVNRVGEDTGVTFAGIPLGHEFTSLVLALLQVSGRPPKVDQKVIDQVKKISGEYHF
ESYISLTCHNCPDVVQALNMMSVLNPNITHTMIDGAAYKAEVESKNIMAVPTVYLNGESF
GSGRMTLEEILAKMGSGTDASEFADKEPFDVLVVGGGPAGASAAIYTARKGIRTGVVAER
FGGQVLDTMSIENFISVKATEGPKLAASLEEHVKEYDIDVMNLQRAKRLEKKDLFELELE
NGAVLKSKTVILSTGARWRNVNVPGEQEFKNKGVAYCPHCDGPLFEGKDVAVIGGGNSGI
EAAIDLAGIVNHVTVLEFAPELKADEVLQKRLYSLPNVTVVKNAQTKEITGDQSVNGITY
VDRETGEEKHVELQGVFVQIGLVPNTEWLEGTVERNRMGEIIVDKHGATSVPGLFAAGDC
TDSAYNQIIISMGSGATAALGAFDYLIRN
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
ttggtacttgatgcaaatatcaaagcacaattaaatcaatatatgcagctaattgagaat
gacattgttctcaaagttagcgcaggcgaagatgacacttctaaggacatgctggctctc
gttgatgagctggcttccatgtcatcgaaaatttcagttgaaaaagctgaattaaacaga
acgccgagcttcagtgtcaatcgtgtcggagaagacactggcgtgactttcgccggtatc
cctctgggccacgaattcacatcattagtgttggcgttgctccaagtgagcggcagaccg
cctaaggtagaccaaaaagtcattgatcaggtgaagaagatcagtggtgaataccacttc
gaatcttatatcagcctgacatgccacaactgtcctgatgttgtacaagctttaaacatg
atgagcgtgctgaacccgaacattacgcacacgatgattgacggtgcagcatacaaagca
gaagttgaaagcaaaaacatcatggcagtgccgaccgtttacctgaatggcgaatccttc
ggaagcggccgtatgacgcttgaagaaattcttgcgaaaatgggcagcggcacagatgca
tctgagtttgctgacaaagagccgtttgacgttcttgtggtcggaggcggacctgctggt
gcaagtgcagcgatctacactgcacgtaaaggcatccgaactggtgttgtcgctgagcgc
ttcggcggacaggttctcgacaccatgagcatcgaaaacttcatcagcgtcaaagcgacg
gaaggaccgaagctagcggcaagtcttgaagagcatgtgaaggaatatgatattgatgtc
atgaaccttcagcgtgcgaaacgccttgagaagaaagatctgttcgaacttgaactcgaa
aacggcgctgtcctgaaaagtaaaacagtgatcctttcaacaggtgcacgctggcgcaat
gtcaacgtccccggtgaacaagagttcaaaaacaaaggtgtcgcatactgcccgcactgt
gatgggccattgtttgaaggcaaagacgttgcggtaatcggcggcggaaactctggtatc
gaagcagcgattgatcttgcaggtattgtcaatcacgttactgtactagaattcgcgccg
gaactgaaagcagacgaagtcctgcaaaaacgtctctacagcctgcctaacgttactgtc
gtgaaaaacgcacaaacaaaagaaatcacaggtgatcagagtgttaacggcatcacatat
gtagaccgcgaaacaggcgaagaaaaacacgttgaacttcaaggtgtattcgtccaaatc
ggtctcgtgccaaacacagaatggttagaaggaacggttgaacgcaaccgcatgggcgaa
attattgtcgacaaacacggcgcaacaagcgtaccaggcttatttgctgccggcgactgc
acagacagtgcgtacaaccaaattattatttctatgggatcaggtgcaactgccgccctc
ggcgcgtttgattacctaatccgtaactaa

DBGET integrated database retrieval system