KEGG   Bacillus subtilis QB928: B657_03340Help
Entry
B657_03340        CDS       T02292                                 

Gene name
folEB
Definition
(GenBank) GTP cyclohydrolase I
  KO
K09007  GTP cyclohydrolase IB [EC:3.5.4.16]
Organism
bsq  Bacillus subtilis QB928
Pathway
bsq00790  Folate biosynthesis
bsq01100  Metabolic pathways
Module
bsq_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bsq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    B657_03340 (folEB)
Enzymes [BR:bsq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     B657_03340 (folEB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCHY-1 DUF3091
Motif
Other DBs
NCBI-ProteinID: AFQ56268
LinkDB All DBs
Position
364271..365185
Genome map
AA seq 304 aa AA seqDB search
MNQHTLLPKKTERLQYFGSVSPIKGEKPVEKEKMKDLQNIRKDYFFDIQHVGVANVSHPV
TITSAMMPAEQTTAANFTMTCNLPRNQKGINMSRLTELLQVYHQNGWILSFSSLQQFTKE
LAENMDTSSATVEVRFPWFFERKSPKLEKAGLMHADIFMSVTYRKDQPFKQRAGISAKVT
TLCPCSKEISEYSAHNQRGTVSIWADIHPAASLPSDVKADLLHAAESNASARLHPVLKRP
DEKAVTETAYENPRFVEDLARLIAADLFELEWVSAFEIECRNEESIHLHDAYAKLCFSKE
VDKI
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaacatacgctgctcccgaaaaaaacggagcgtcttcaatactttggatcggtc
agtccgatcaaaggcgagaaaccagtggaaaaagagaaaatgaaggacctgcaaaatatc
aggaaggattatttttttgacattcagcatgtaggtgtagctaatgtgtcccatccagtc
acaatcacttctgccatgatgcctgccgagcaaacaacggctgcgaactttacaatgact
tgtaatttgccgagaaatcagaaggggattaacatgagccggttaacagagctgctgcaa
gtctatcatcaaaatggctggattctctcattttcctctcttcagcaatttacgaaagag
cttgcagaaaacatggacacatcatctgccacagttgaagtgaggtttccgtggtttttc
gaacggaaaagcccgaagcttgagaaagcgggtttgatgcatgctgatatattcatgtct
gtcacctatcgcaaagatcagccgtttaaacagcgtgccggcatctcagcaaaagtaacg
actctgtgcccttgctccaaggaaatcagcgaatacagtgcccataatcagaggggaacg
gtcagcatttgggcggatattcacccggccgcatcgctgccaagtgatgttaaagctgat
ttgcttcacgccgcagaatcaaatgcttctgcgagactgcatccggtattgaagcggcct
gatgaaaaagccgtgacagaaacggcctatgaaaacccgagatttgttgaggatctcgcc
cggctgattgctgcagatttgtttgagcttgaatgggtgtcagcctttgagattgaatgc
cgaaatgaagaatcgatccatcttcacgatgcctatgcgaagctgtgtttttcgaaggaa
gtggataaaatatga

DBGET integrated database retrieval system