KEGG   Bacillus subtilis QB928: B657_03370Help
Entry
B657_03370        CDS       T02292                                 

Gene name
yckA
Definition
(GenBank) Putative ABC transporter (permease)
  KO
K10009  L-cystine transport system permease protein
Organism
bsq  Bacillus subtilis QB928
Pathway
bsq02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsq00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    B657_03370 (yckA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsq02000]
    B657_03370 (yckA)
Transporters [BR:bsq02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Cystine transporter
    B657_03370 (yckA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AFQ56272
LinkDB All DBs
Position
complement(367317..367997)
Genome map
AA seq 226 aa AA seqDB search
MINSIQWEYIFNTKLAIESFPYVIKGIGYTLLISFVSMFAGTVIGLFISLARMSKLALLR
WPAKLYISFMRGVPILVILFILYFGFPYIGIEFSAVTAALIGFSLNSAAYIAEINRSAIS
SVEKGQWEAASSLGLSYWQTMRGIILPQSIRIALPPLANVLLDLIKASSLAAMITVPELL
QHAKIIGGREFDYMTMYILTALIYWAICSIAAVFQNILEKKYAHYV
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgatcaatagcattcagtgggaatatattttcaacacgaagctggccattgaatcgttc
ccttatgtcataaaaggcattggttatacactgctcatctcttttgtaagcatgtttgcg
ggaactgtgatcggcctgttcatatcactcgccagaatgtctaaacttgctttgttaaga
tggccggcgaagctctatatctcatttatgcgaggcgttccgattttggtgattttgttt
atcctttatttcgggtttccttatatcggcattgaattttccgctgtcacggctgcttta
atcggctttagcctaaacagcgccgcctacattgcggaaattaaccgttcagccatttca
tccgtcgaaaaaggacagtgggaagccgcatcctcgctgggtctttcctattggcagacg
atgaggggcatcattttgccgcaatcgatacgtattgcgctgcctccgcttgccaatgta
ttgctcgacttgatcaaggcgtcctctctcgctgcgatgattacagtgccggaattgctc
cagcatgcgaaaatcatcgggggcagagagtttgattatatgaccatgtatattctgacc
gctctcatttattgggccatctgctccattgccgcggtctttcagaatatccttgagaaa
aaatacgctcattatgtttaa

DBGET integrated database retrieval system