KEGG   Bacillus subtilis QB928: B657_03380Help
Entry
B657_03380        CDS       T02292                                 

Gene name
yckB
Definition
(GenBank) Putative ABC transporter (binding lipoprotein)
  KO
K02424  L-cystine transport system substrate-binding protein
Organism
bsq  Bacillus subtilis QB928
Pathway
bsq02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsq00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    B657_03380 (yckB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsq02000]
    B657_03380 (yckB)
   02035 Bacterial motility proteins [BR:bsq02035]
    B657_03380 (yckB)
Transporters [BR:bsq02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Cystine transporter
    B657_03380 (yckB)
Bacterial motility proteins [BR:bsq02035]
 Flagellar system
  Flagellar assembly proteins
   Chaperones
    B657_03380 (yckB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd Phosphonate-bd NMT1 DUF3692
Motif
Other DBs
NCBI-ProteinID: AFQ56273
LinkDB All DBs
Structure
PDB: 

Position
complement(368007..368870)
Genome map
AA seq 287 aa AA seqDB search
MKSFMHSKAVIFSFTMAFFLILAACSGKNEADSKDTGWEQIKDKGKIVVATSGTLYPTSY
HDTDSGSDKLTGYEVEVVREAAKRLGLKVEFKEMGIDGMLTAVNSGQVDAAANDIDVTKD
REEKFAFSTPYKYSYGTAIVRKDDLSGIKTLKDLKGKKAAGAATTVYMEVARKYGAKEVI
YDNATNEQYLKDVANGRTDVILNDYYLQTLALAAFPDLNITIHPDIKYMPNKQALVMKKS
NAALQKKMNEALKEMSKDGSLTKLSKQFFNKADVSKKIDADVQDVDL
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
gtgaaatcattcatgcattccaaagccgttatattcagtttcacaatggctttctttctt
atattggcagcctgttccggcaaaaatgaagccgattccaaggatacaggctgggagcag
attaaggataaagggaaaatcgtagtcgctacatcaggtacgctctatcccacttcttat
cacgatactgactctggctctgataagctgacgggctacgaggttgaagttgttcgtgaa
gcggcaaaacgcttggggctgaaggttgagttcaaggagatgggcattgacgggatgctg
acagcggtgaacagcggacaggttgacgcagccgcgaatgacatcgatgtgacgaaggac
cgtgaggagaagttcgcattttccactccatataaatattcatacggcacggcaattgtc
cgaaaagacgatttatcagggattaaaacgctcaaggatttaaaagggaagaaagcggct
ggcgcggctacaaccgtctacatggaggtcgcgagaaaatacggcgccaaagaagtgatt
tatgataatgcgacgaatgagcaatatttaaaagatgttgccaacggacgcactgacgtc
attttaaacgactattacctgcagacacttgcgctcgcggcattcccggatctcaacatt
acaattcatcctgacatcaagtacatgccgaacaaacaggcccttgtcatgaaaaaaagc
aatgcggcacttcagaaaaagatgaacgaagcattgaaagagatgagcaaggatggctct
ttgactaaactgtcgaaacaattcttcaataaagcagatgtatcaaaaaaaattgatgcc
gacgttcaggacgttgatttgtaa

DBGET integrated database retrieval system