KEGG   Bacillus subtilis QB928: B657_03390Help
Entry
B657_03390        CDS       T02292                                 

Gene name
yckC
Definition
(GenBank) Putative integral inner membrane protein
Organism
bsq  Bacillus subtilis QB928
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RDD ABC_export DUF2070
Motif
Other DBs
NCBI-ProteinID: AFQ56274
LinkDB All DBs
Position
369248..369703
Genome map
AA seq 151 aa AA seqDB search
MNIYKPAGFWIRLGAALLDYIIVSVPLLLIYWLITGKDPNDSMFISLVVLLYSILLPMFW
RGYLIGKRICGIRIVKKDGSQVSLLTMFLRVIVAGLVYCITFGLGLIASLILIAVREDKR
TLHDLIAGTYVTYATPGEEELNADEEIRKSE
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgaatatttacaaaccagccggattttggatcagacttggagctgcattgttagactac
attatagtctccgtgccgcttttgctgatctattggctgattacaggaaaagacccaaac
gacagcatgttcatcagtttggttgttctgctgtattctattttgctgccgatgttttgg
cgcggttatcttatcggaaaaaggatctgcggaatcagaatcgtaaaaaaagacggatca
caggtcagtctgttaacaatgtttttacgggttattgtagccggcctggtttactgtata
accttcggactcggcttgatcgccagcctgattctgattgccgtacgagaagacaaacgg
accctgcatgatttaatcgcgggaacatatgtcacttatgcgacaccaggtgaagaggaa
cttaatgctgacgaagagattagaaagagcgaataa

DBGET integrated database retrieval system