KEGG   Bacillus subtilis QB928: B657_09460Help
Entry
B657_09460        CDS       T02292                                 

Gene name
ctrA
Definition
(GenBank) Branched-chain amino acid transporter
  KO
K03294  basic amino acid/polyamine antiporter, APA family
Organism
bsq  Bacillus subtilis QB928
Brite
KEGG Orthology (KO) [BR:bsq00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    B657_09460 (ctrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease_2 AA_permease AA_permease_C Spore_permease
Motif
Other DBs
NCBI-ProteinID: AFQ56863
LinkDB All DBs
Position
1002847..1004244
Genome map
AA seq 465 aa AA seqDB search
MKGSVFRKKSIQDLIAATSGEKSLKRELGAFDLTLLGIGAIIGTGIFVLTGTGAVTAGPG
LTISFVVAALACLFAALSYAEFASSVPVSGSVYTFTYATLGELMAFIIGWDLILEYMLAV
SAVSVGWSGYFQSFLSGLGIHLPVALTAAPGAVKGTFTLFNLPAFVIVMAITYLLYLGIK
ESKRVNNIMVILKILVVLLFIAVAAVYVKPHNWQPFMPMGFGGVFSAAALVFFAFIGFDA
VSSAAEETKNPAKDLPKGIIFSLLVCTILYVTVSAIMTGVIPFAQFAGVDHPVSLVLQSA
GQNWVAGIIDIGAVLGMTTVMLVMLYGQTRVMFAMSRDGLVPGSLSKVHPKHKTPYVATW
FFGTMSALLGSLVPLDELAKLVNIGTLSAFVLISVAVIVLRKKQPDLPRAFKCPGVPVIP
GLAILFCLFLILNLGWVTIVRFLVWLLIGLVIYFLYSRKHSKLNQ
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgaaagggagcgtttttaggaagaaaagcattcaggatttaatcgctgcgacgagcggg
gaaaagtctttaaaaagagaattaggggcatttgatttaacgttgcttggaatcggcgcc
attattggcacagggatttttgttctgacgggaacaggcgcagtcacggccggtcccggg
ctgacgatttcatttgttgtggcggcgttggcttgtttattcgccgccctgtcttacgcg
gaatttgcgtcaagtgtgcctgtttcaggttcggtgtatacattcacttatgcgacattg
ggagagcttatggcctttattatcgggtgggatttaattttagaatacatgctggcggta
agtgcagtgtcggtcggctggtctggttatttccaatcgtttttatcagggcttggcatt
catcttccggttgctttaacagcggcaccgggcgcagtgaaaggcacctttaccctgttt
aatcttcctgcattcgtcattgtaatggcgatcacatatttgctttatttaggcatcaaa
gaatcaaaaagagtcaacaatatcatggttatcttgaagatactggttgttctgctgttt
atcgcggtggcagccgtttacgtgaagccgcacaactggcagccgtttatgccaatgggc
tttggcggcgtgttcagtgcagcggcgctcgtattctttgcttttatcggatttgacgct
gtatcctctgctgcggaagaaacgaaaaatcccgcgaaggatctgcctaaaggcattatt
ttctctttactggtctgcacgattttatatgtcaccgtatcagccatcatgactggggtt
atcccgtttgctcaatttgcgggtgtggatcatccggtttctcttgttcttcaaagcgca
gggcaaaattgggtggcaggcatcattgatattggcgccgtgttgggaatgacaacagtt
atgctcgtgatgctttacgggcagacccgcgtcatgtttgccatgtcgcgtgacggactt
gtgccgggttcactttctaaagtgcatccaaagcacaaaacaccttatgtagccacttgg
tttttcggaacgatgtcggcgcttctcggctcacttgttccgctggatgaacttgcaaag
ctggtgaacatcgggacgttgtcggcatttgtcctgatttctgtggcagttatcgttttg
agaaagaaacagcctgatcttccgagagcttttaaatgcccgggagttcccgtgatccca
ggcctggcgattctgttctgcctgttcttgattttaaatctgggatgggtgacgattgtc
cgcttcctagtgtggctgttaatcggcttggtaatctatttcctgtattcaagaaagcat
tcaaaattaaatcaataa

DBGET integrated database retrieval system