KEGG   Bacillus subtilis QB928: B657_18480Help
Entry
B657_18480        CDS       T02292                                 

Gene name
proH
Definition
(GenBank) Pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
bsq  Bacillus subtilis QB928
Pathway
bsq00330  Arginine and proline metabolism
bsq01100  Metabolic pathways
bsq01110  Biosynthesis of secondary metabolites
bsq01130  Biosynthesis of antibiotics
bsq01230  Biosynthesis of amino acids
Module
bsq_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:bsq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    B657_18480 (proH)
Enzymes [BR:bsq01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     B657_18480 (proH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored Shikimate_DH ApbA Sacchrp_dh_NADP NAD_binding_2 NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-ProteinID: AFQ57781
LinkDB All DBs
Position
complement(1996340..1997233)
Genome map
AA seq 297 aa AA seqDB search
MRTKKRTKEMLPIFDQKKVAFIGAGSMAEGMISGIVRANKIPKQNICVTNRSNTERLTEL
ELQYGIKGALPNQLCIEDMDVLILAMKPKDAENALSSLKSRIQPHQLILSVLAGITTSFI
EQSLLNEQPVVRVMPNTSSMIGASATAIALGKYVSEDLKKLAEALLGCMGEVYTIQENQM
DIFTGIAGSGPAYFYYLMEFIEKTGEEAGLDKQLSRSIGAQTLLGAAKMLMETGEHPEIL
RDNITSPNGTTAAGLQALKKSGGGEAISQAIKHAAKRSKEISEDIEKTAAPLSGVIK
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgcgaacaaaaaagcgaacaaaggagatgttaccgatctttgatcaaaagaaagtagcc
tttataggagcaggatctatggcggaaggaatgatatcaggtatcgttcgagccaacaaa
atcccgaaacaaaacatctgcgttacaaaccgcagcaatacagagcgattaactgaactt
gaacttcaatatggcattaaaggcgccttgccgaaccaactatgtattgaagacatggat
gtgctcattttggcaatgaagccaaaagacgccgaaaacgctctgtcatcactaaaatca
cgtattcaaccccatcaattaatattgtcggtccttgccggcataactacctcttttatt
gaacaatcattgcttaatgaacagccggttgtcagagtgatgcccaacacttccagtatg
attggcgcttctgcaacagctattgcccttggcaaatatgtgtcggaagacctgaagaag
ctggccgaagcattgctcggatgcatgggcgaagtctatacaatccaagaaaatcaaatg
gatatattcaccggaattgcaggcagcggacccgcgtatttttattatttaatggaattc
attgaaaagacaggcgaggaagcgggcctcgataaacagttatctcgaagcatcggcgca
cagacacttttaggtgccgcaaaaatgctcatggaaacaggagaacatcctgagatctta
agagataatatcacgtcaccgaacggaacgacagcagcggggctgcaagccttgaaaaag
agcggcggcggagaagcgatttctcaagcaataaagcatgcggctaagcgttcaaaggaa
atcagcgaagatatcgaaaaaactgcagcgccgctatcaggagtgataaagtga

DBGET integrated database retrieval system