KEGG   Bacillus subtilis QB928: B657_19710Help
Entry
B657_19710        CDS       T02292                                 

Gene name
yodQ
Definition
(GenBank) Putative deacylase
  KO
K01438  acetylornithine deacetylase [EC:3.5.1.16]
Organism
bsq  Bacillus subtilis QB928
Pathway
bsq00220  Arginine biosynthesis
bsq01100  Metabolic pathways
bsq01110  Biosynthesis of secondary metabolites
bsq01130  Biosynthesis of antibiotics
bsq01210  2-Oxocarboxylic acid metabolism
bsq01230  Biosynthesis of amino acids
Module
bsq_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:bsq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    B657_19710 (yodQ)
Enzymes [BR:bsq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.16  acetylornithine deacetylase
     B657_19710 (yodQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer DUF3762
Motif
Other DBs
NCBI-ProteinID: AFQ57915
LinkDB All DBs
Position
complement(2121198..2122508)
Genome map
AA seq 436 aa AA seqDB search
MRMQDIERKVIEWLDQHSAKAIRLLKRLIGEKSTLGSEFNAQAVVLEKLRQFHMDIDVWE
PSIKQLKQHPYFKSNRSDFHESPNIVAKKTGAGGGRSLILNGHIDVVPEGSVKDWKYEPY
QAVEENGKIYGRGSTDMKGGNTALLFALEALHACDVKLKGDVLFQSVVDEECGGAGTLSA
IMRGYRADGALIPEPTNMKLFIKQQGSMWFRITVKGLSAHGGTRYEGVSAIEKSMHVITA
IQELEKVRNARISDPLYDNIPIPVPVNIGTISGGAWPSSVADRVVIEGRCGIAPHEKPEA
VKLELENWLKDLEYHDEWFKRHPVQVEWFGAQWLPNDLPDDHPLISVLQSAYQKMKQTEP
IIEASPWGTDGGLLYHAGDTPVIVFGPGETKTAHQANEYIEVEAMIESAKIIALFVMDWC
GLHTDGEDADAQVNKE
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgaggatgcaagacattgaaagaaaagtaatcgagtggcttgatcagcattcggccaaa
gccattcgtcttctcaaaaggctgattggggaaaaaagcacattggggtcagagtttaac
gcccaagctgttgtgcttgaaaagctgcggcaatttcatatggacattgatgtatgggag
ccaagcataaagcaattaaaacagcatccctactttaaatctaaccgatccgattttcat
gagagcccgaatatcgtggctaaaaaaacgggagccggcggaggcaggtccctgattttg
aacggccatatcgatgttgtgcctgaaggaagcgtaaaggattggaagtatgaaccgtat
caagctgtcgaagaaaacggtaaaatatacggccgcggctcaacggatatgaagggaggc
aatacagcccttctttttgctttagaagccctgcacgcctgcgatgtcaaactgaaggga
gatgtattgtttcagagtgttgtagatgaagagtgcggcggcgccggtacactttccgcc
atcatgagaggctatcgtgctgacggggcgctgattcctgaaccgacgaatatgaaacta
tttattaagcagcagggttcgatgtggtttcggatcactgtgaagggattatccgcacat
gggggcacacgctatgaaggggtaagcgcgattgaaaaaagcatgcacgttatcacagcg
atacaagagctggagaaagtccgcaatgcgagaatttcagatccgctgtatgacaatatc
ccaataccggtaccggtgaatatcggcaccatctcaggcggtgcctggccatcttcagtt
gcagaccgtgtcgtcatagaagggagatgcggaattgctccccatgagaaaccagaagct
gtaaaacttgaattggaaaactggctgaaggatttagaataccatgacgaatggtttaaa
cgccatcccgtacaagtcgaatggtttggcgctcaatggctgccgaatgatttacctgat
gatcaccctttaatttctgtgctgcaatcagcctatcaaaaaatgaaacagacagagccg
attattgaggcttccccgtggggaacggatggagggcttttgtaccatgcaggagataca
ccagtgatcgttttcgggccgggggaaacaaaaacggctcatcaggccaatgaatacatt
gaggttgaagccatgatagaatctgctaaaattattgcactttttgtcatggattggtgc
ggccttcatacagatggggaggatgcggatgctcaagtcaataaagagtag

DBGET integrated database retrieval system