KEGG   Bacillus subtilis QB928: B657_20100
Entry
B657_20100        CDS       T02292                                 
Name
(GenBank) YosJ
Organism
bsq  Bacillus subtilis QB928
SSDB
Motif
Pfam: DUF4371 DUF982
Other DBs
NCBI-ProteinID: AFQ57952
LinkDB
Position
complement(2146153..2146347)
AA seq 64 aa
MIQGFYKDQKLHLLEDPMQQYTVMKVEENAVCVYRWIDDYRHKIERFTDVEEAKKLLGEG
WPKQ
NT seq 195 nt   +upstreamnt  +downstreamnt
atgattcaagggttttataaagatcagaaacttcatcttctagaagatcctatgcagcag
tacaccgtcatgaaagttgaagaaaatgcagtatgtgtttaccggtggatcgatgattat
agacacaagattgaaagattcacagatgttgaagaggctaaaaaactccttggagaaggg
tggccgaaacaatag

DBGET integrated database retrieval system