KEGG   Bacillus subtilis QB928: B657_21430Help
Entry
B657_21430        CDS       T02292                                 

Gene name
bhlB
Definition
(GenBank) Holin-like bacteriophage SPbeta protein
Organism
bsq  Bacillus subtilis QB928
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Holin_SPP1
Motif
Other DBs
NCBI-ProteinID: AFQ58090
LinkDB All DBs
Position
2244396..2244662
Genome map
AA seq 88 aa AA seqDB search
MFENIDKGTIVRTLLLAIALLNQIMVMLGKAAFIINEEDINHLYDCLYTIFTIVFTTSTT
TAAWFKNNYITAKGKKQKQVLKKENLFK
NT seq 267 nt NT seq  +upstreamnt  +downstreamnt
atgtttgagaatattgataaaggcacaattgttaggactcttttgctcgcaatagcttta
ctcaatcaaataatggtgatgctgggtaaagcagcattcatcattaacgaagaggacata
aatcatttatatgattgtttatatacaattttcactatcgtcttcacaaccagtactact
accgcagcatggttcaaaaacaattacataactgcaaaaggaaaaaaacaaaaacaagtt
ctaaaaaaagagaacttgtttaaatag

DBGET integrated database retrieval system