KEGG   Bacillus subtilis QB928: B657_27050
Entry
B657_27050        CDS       T02292                                 

Gene name
levF
Definition
(GenBank) Phosphotransferase system (PTS) fructose-specific enzyme
  KO
K11196  fructose PTS system EIIC component
Organism
bsq  Bacillus subtilis QB928
Pathway
bsq00051  Fructose and mannose metabolism
bsq02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bsq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    B657_27050 (levF)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    B657_27050 (levF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsq02000]
    B657_27050 (levF)
Transporters [BR:bsq02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    B657_27050 (levF)
SSDB
Motif
Pfam: EII-Sor TMEM251
Other DBs
NCBI-ProteinID: AFQ58546
LinkDB
Position
complement(2692520..2693329)
AA seq 269 aa
MSSLQIILLLIIAAITGIASVLDEGQTHRPLVACTLVGLVLGDLKTGIILGGTLELMALG
WMNVGLAMAPDTAIASVISTILVITADQGIGEGIAVAVALAAAGQALTIFVRTITVFFIH
RADQYAKAGNIKGIEIMHITAMVFQALRVMIPTLIVALISVSAVQAFLGNIPDVITKGLQ
IGGGIIVVVGYAMVINMMNIPYLKPFFYIGFLLAAFTDFNLVGFGALGLCLALLYQQVMQ
KQSAHGAVAAASDSGSVAVYDDDDDDLDA
NT seq 810 nt   +upstreamnt  +downstreamnt
atgtcttcattacaaattattttgttgttaatcattgcagcaatcaccggaatcgcaagt
gtattggatgaagggcagacacaccggccgctagtggcctgtacgttggttggcttggtg
ctcggggacttaaaaacgggaattattcttggaggcacactggagctgatggcgctcggc
tggatgaacgtcgggcttgccatggcacctgatacagcgatcgcctctgtcatctcaacc
attttagttattaccgctgatcaaggaattggcgaagggattgctgtcgctgttgcttta
gcagctgcgggtcaggcgctgacgatttttgttcggacgatcactgtctttttcatccac
cgcgctgatcaatatgcaaaagcgggaaatataaaaggaattgaaattatgcatattacc
gcgatggtgtttcaagctttgcgcgtcatgattcctacattgattgttgctttaattagt
gtcagcgctgttcaggcgttcctgggaaatattcctgatgtcattacaaaaggactgcaa
ataggcggaggcattattgtggttgtcgggtatgccatggtgatcaatatgatgaatatt
ccttatttaaagccatttttctatattggtttcttattagcggcgtttaccgattttaac
ttagtgggatttggagcccttggtctctgtctggcgcttttataccagcaggtgatgcaa
aaacaaagcgctcacggagcagtcgcggccgcatcagacagtggcagtgttgctgtttat
gatgacgatgatgatgatcttgatgcctaa

DBGET integrated database retrieval system