KEGG   Bacillus subtilis QB928: B657_29190Help
Entry
B657_29190        CDS       T02292                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bsq  Bacillus subtilis QB928
Pathway
bsq00010  Glycolysis / Gluconeogenesis
bsq00030  Pentose phosphate pathway
bsq00051  Fructose and mannose metabolism
bsq00052  Galactose metabolism
bsq00680  Methane metabolism
bsq01100  Metabolic pathways
bsq01110  Biosynthesis of secondary metabolites
bsq01120  Microbial metabolism in diverse environments
bsq01130  Biosynthesis of antibiotics
bsq01200  Carbon metabolism
bsq01230  Biosynthesis of amino acids
bsq03018  RNA degradation
Module
bsq_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bsq_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:bsq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B657_29190 (pfkA)
   00030 Pentose phosphate pathway
    B657_29190 (pfkA)
   00051 Fructose and mannose metabolism
    B657_29190 (pfkA)
   00052 Galactose metabolism
    B657_29190 (pfkA)
  09102 Energy metabolism
   00680 Methane metabolism
    B657_29190 (pfkA)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    B657_29190 (pfkA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:bsq01009]
    B657_29190 (pfkA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:bsq03019]
    B657_29190 (pfkA)
Enzymes [BR:bsq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     B657_29190 (pfkA)
Protein phosphatases and associated proteins [BR:bsq01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     B657_29190 (pfkA)
Messenger RNA biogenesis [BR:bsq03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     B657_29190 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: AFQ58763
LinkDB All DBs
Structure
PDB: 

Position
complement(2918027..2918986)
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAVRAVVRKAIYHDVEVYGIYNGYAGLISGKIEKLELGSVGDI
IHRGGTKLYTARCPEFKTVEGREKGIANLKKLGIEGLVVIGGDGSYMGAKKLTEHGFPCV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWA
GLAGGAESILIPEADYDMHEIIARLKRGHERGKKHSIIIVAEGVGSGVEFGKRIEEETNL
ETRVSVLGHIQRGGSPSAADRVLASRLGAYAVELLLEGKGGRCVGIQNNKLVDHDIIEIL
ETKHTVEQNMYQLSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaataggggtattaacgagcggcggggattccccgggaatgaacgcagcagtt
cgcgcagtagtcagaaaagcgatctatcatgacgttgaagtttacggtatttacaacgga
tacgcgggattgatcagcggaaagattgaaaagcttgaactcggatcagtaggcgatatt
atacatcgtggagggactaagctttatacggcgagatgtcctgaattcaaaacagttgaa
ggccgtgaaaaagggatagcaaacttgaagaagcttggtattgaaggccttgttgttatc
ggtggagacggttcctatatgggtgcgaaaaaattaacggaacacgggtttccatgtgta
ggtgtaccgggtacaattgataatgacattccgggcactgattttacaatcggtttcgat
acagctttaaatacagtaattgacgcaattgataagattcgcgatacagcgacttctcat
gaacgtacatatgtaatcgaagtaatgggccgtcatgccggcgatatcgcattgtgggcc
ggtcttgcagggggcgcagaatcgatcttaatccctgaggcagactatgacatgcacgaa
atcattgcccgcttaaaacgcggccacgaacgcggcaagaagcacagtattattattgtt
gccgaaggtgtaggcagcggtgttgaattcgggaaacgcattgaagaagaaacaaatctt
gaaactagggtatctgtattgggccatatccagcgcggaggttctccgagtgctgctgac
cgtgtgttggcaagccgtctcggcgcatatgcagttgaactgctgcttgaaggaaaaggc
ggacgctgtgtaggtatacaaaacaataagcttgtagaccatgatattatagaaatactt
gagacaaaacacacagttgagcaaaacatgtatcagctttcaaaagaactgtctatctaa

DBGET integrated database retrieval system