KEGG   Bacillus subtilis QB928: B657_32780Help
Entry
B657_32780        CDS       T02292                                 

Gene name
yusF
Definition
(GenBank) Putative ribonuclease
  KO
K07476  toprim domain protein
Organism
bsq  Bacillus subtilis QB928
Brite
KEGG Orthology (KO) [BR:bsq00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    B657_32780 (yusF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim Toprim_4 Toprim_2 Borrelia_lipo_1
Motif
Other DBs
NCBI-ProteinID: AFQ59126
LinkDB All DBs
Position
complement(3296832..3297281)
Genome map
AA seq 149 aa AA seqDB search
MVLMLAVNFTAFFYNLNISNLTRQVNKMKMDELEKVMIVEGKSDKEKIESVLNEPMRIIC
TNGTISQLRLEELADELYDKDVYILVDADESGEKLRKQLKREFNEACHLHVDRAYKEVAA
APRHHIASVLLRANLNVHTIFLERKSRGV
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
ctggtgttaatgttggcggtgaatttcactgccttcttttacaatctgaacatttcaaat
ttgacgcggcaggtgaacaagatgaagatggatgagctggaaaaggttatgattgtcgag
gggaaatcagataaagagaaaatcgaaagcgtcctgaatgaaccgatgcgcattatctgc
acaaacggaacaatcagccagctgaggctcgaggaattggctgacgagctttatgataaa
gacgtctatatattagttgatgctgatgaatcaggtgagaaattgagaaaacagctgaag
cgtgaatttaatgaagcctgccatctccatgtcgacagagcctataaggaagtagcggct
gcgcccaggcaccatatcgcttctgtattgctgcgtgcgaatctgaatgtccatactatt
tttcttgaaagaaagtcccgaggtgtatag

DBGET integrated database retrieval system