KEGG   Bacillus subtilis QB928: B657_32840Help
Entry
B657_32840        CDS       T02292                                 

Gene name
fadN
Definition
(GenBank) Enoyl-CoA hydratase / 3-hydroxyacyl-CoAdehydrogenase
  KO
K07516  3-hydroxyacyl-CoA dehydrogenase [EC:1.1.1.35]
Organism
bsq  Bacillus subtilis QB928
Pathway
bsq00071  Fatty acid degradation
bsq00362  Benzoate degradation
bsq00650  Butanoate metabolism
bsq01100  Metabolic pathways
bsq01120  Microbial metabolism in diverse environments
bsq01200  Carbon metabolism
bsq01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bsq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    B657_32840 (fadN)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    B657_32840 (fadN)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    B657_32840 (fadN)
Enzymes [BR:bsq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     B657_32840 (fadN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N 3HCDH ECH_1 ECH_2 NAD_binding_2 ApbA DUF3298 Lipase_GDSL_3 Pyr_redox_2 2-Hacid_dh_C DUF4342
Motif
Other DBs
NCBI-ProteinID: AFQ59132
LinkDB All DBs
Position
complement(3301466..3303940)
Genome map
AA seq 824 aa AA seqDB search
MKSNRKSFKMKEETGFIFFSQKMNDYSFNVQGGYLMHKHIRKAAVLGSGVMGSGIAAHLA
NIGIPVLLLDIVPNDLTKEEEKKGLTKDSSEVRSRLSRQAMKKLLKQKPAPLTSAKNTSY
ITPGNLEDDAEKLKEADWIIEVVVENLEVKKKIFALVDEHRKTGSIVSSNTSGISVQEMA
EGRSDDFKAHFLGTHFFNPARYLKLLEIIPIKETDPDILKFMTAFGENVLGKGVVTAKDT
PNFIANRIGTYGLLVTVQEMLKGGYQVGEVDSITGPLIGRPKSATFRTLDVVGLDTFAHV
ARNVYDKADGDEKEVFRIPSFMNDMLEKGWIGSKAGQGFYKKEGKTIYELDPVTLTYGER
TKMKSPALEAAKQAKGTKAKMKALIYSDDRAGRLLWNITSQTLLYSAELLGEIADDIHAI
DQAMKWGFGWELGPFEMWDAIGLKQSAEKLEQLGADMPGWIKEMLDKGNETFYIKENGTV
FYYDRGEYRAVKENKKRIHLQALKETKGVIAKNSGASLIDLGDDVALLEFHSKSNAIGLD
IIQMIHKGLEETERNYKGLVIGNQGKNFCVGANLAMILMEVQDDNFLEVDFVIRRFQETM
MKIKYSAKPVVAAPFGMTLGGGTEACLPAARIQAASEAYMGLVESGVGLIPGGGGNKELY
INHLRRGHDPMNAAMKTFETIAMAKVSASAQEAREMNILKETDQISVNQDHLLYDAKQLA
ASLYDTGWRPPVKEKVKVPGETGYAALLLGAEQMKLSGYISEHDFKIAKKLAYVIAGGKV
PFGTEVDEEYLLEIEREAFLSLSGEAKSQARMQHMLVKGKPLRN
NT seq 2475 nt NT seq  +upstreamnt  +downstreamnt
ttgaagtcgaaccggaaatcttttaagatgaaagaagaaacgggtttcattttttttagt
caaaaaatgaatgactattcattcaatgttcaagggggatatctcatgcacaaacacatt
cggaaggcagccgttttaggatcgggggtaatgggttccgggatagcggcgcatttggct
aacatcggaattcctgtcctgctgctagatattgtgccgaacgatttgacaaaggaagag
gaaaaaaaggggctgacgaaggacagttcggaggtgcgcagcaggctgagccggcaggcg
atgaaaaaactgctgaaacaaaagcccgctcccctcacatcagcgaaaaatacctcctat
attacacctggcaatctggaggatgatgcagaaaaactgaaagaagcagattggattatt
gaggtcgttgtcgaaaaccttgaagtcaaaaagaaaattttcgctcttgtggatgaacat
cgaaagactggaagcatcgtctcaagcaacacatccggcatatcagtgcaggaaatggct
gaaggccggtcggatgattttaaagcccattttcttggaacgcatttttttaatcccgca
cgatatttaaagctgctagagatcattccgattaaggaaacggatcctgatattttaaag
tttatgacagctttcggagaaaatgtcctcgggaaaggcgttgttacagcaaaggacaca
ccgaactttatcgcaaaccgcatcgggacttacgggcttctcgtgacagtccaagaaatg
ctgaaaggcggttatcaggtcggggaggttgattcgatcacaggaccgctgatcggcagg
ccgaaaagcgccacctttagaacgcttgatgtggtcggcctcgatacattcgcccacgtt
gcccgaaatgtgtatgacaaagctgatggcgatgaaaaagaagtgtttcgcattccaagc
ttcatgaacgatatgctggaaaaagggtggatcggaagcaaggccggccaaggcttttat
aaaaaagaaggaaaaacgatttatgagcttgacccagtgacgcttacttacggcgagcgg
acaaaaatgaaatcaccggcacttgaagcggcaaaacaggcaaaagggacaaaagccaaa
atgaaagcgcttatttattcggatgacagggccggccgtttgctgtggaatatcacttct
caaaccctgctttactcagccgagctgcttggcgagattgccgatgatattcatgcgatt
gaccaagccatgaagtggggattcggctgggaactgggaccttttgagatgtgggacgcc
atcggcctcaagcagtcagcggaaaagcttgagcagcttggagcagatatgcctggctgg
ataaaagagatgctggacaaaggaaatgaaaccttctacatcaaagagaacggaacggta
ttttattatgaccgcggcgaatacagagccgtgaaagaaaacaaaaaacgaattcattta
caagcacttaaagaaacaaaaggcgtgattgcgaaaaacagcggagcaagcttaattgac
cttggagatgatgtggcccttcttgaatttcattcgaaaagcaatgcgatcggcctcgat
atcattcaaatgatccacaaaggattagaggaaacagaacggaattacaaggggcttgtc
atcggcaatcaagggaaaaatttctgcgtcggcgcgaatctcgccatgatcttaatggaa
gtccaagatgacaactttttggaagttgattttgtgatccgccgttttcaggagacgatg
atgaagatcaaatacagtgcgaaaccggtcgtcgccgcgccatttggcatgacgctcggc
ggaggaacggaagcatgcctgccggcggcgcgcattcaagcggcaagcgaagcctatatg
ggacttgtggaatccggtgtcggcctcatccctggcggaggaggtaacaaagagctgtac
atcaaccatcttcgccgcggccatgatccgatgaatgcggcaatgaaaacatttgaaaca
atcgcgatggcgaaagtgtccgcttccgctcaagaggctcgtgagatgaacatcttaaaa
gaaacggatcagatcagcgtgaatcaagaccacctgttatacgatgcgaagcagctggcc
gcatctttatacgataccggctggcggccgcctgtaaaagaaaaggtcaaggtgccggga
gaaaccggttatgcggcactcttgcttggcgctgagcagatgaagctgtccggctatata
tctgagcatgattttaagatcgcgaaaaaactcgcttatgtcattgcgggcggaaaagtg
ccgtttggtacagaggttgatgaagagtatttattggagatcgaaagagaagcgtttttg
agtttgtcaggagaggcaaaatctcaagcgagaatgcagcatatgcttgtgaaaggtaaa
cctttacggaattag

DBGET integrated database retrieval system