KEGG   Bacillus subtilis QB928: B657_34860Help
Entry
B657_34860        CDS       T02292                                 

Gene name
hisI
Definition
(GenBank) Phosphoribosyl-AMP cyclohydrolase
  KO
K11755  phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase [EC:3.6.1.31 3.5.4.19]
Organism
bsq  Bacillus subtilis QB928
Pathway
bsq00340  Histidine metabolism
bsq01100  Metabolic pathways
bsq01110  Biosynthesis of secondary metabolites
bsq01230  Biosynthesis of amino acids
Module
bsq_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:bsq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    B657_34860 (hisI)
Enzymes [BR:bsq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     B657_34860 (hisI)
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     B657_34860 (hisI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH PRA-PH MazG
Motif
Other DBs
NCBI-ProteinID: AFQ59338
LinkDB All DBs
Position
complement(3514377..3515006)
Genome map
AA seq 209 aa AA seqDB search
MKQADELRFNEDGLIPAIVQDAASKEVLTLAYMNKESYEKTLETKETWFYSRSRQALWHK
GETSGNTQAVKGIRYDCDQDALLVLVEPSGPACHTGSYSCFTKEQTEEQAADRFGIMNEL
ERVIAERQAEMPEGAYTTYLFREGVDKILKKVGEEASEVIIAAKNRDHEELKWEAADLLY
HLLVLLREQSLPLDDVLDVLKKRHSEIEE
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaggcagatgaactgcgttttaacgaggacggattaattcctgctatcgtgcag
gatgcggcaagcaaagaagtgctgacacttgcgtatatgaacaaggaatcgtacgaaaaa
acgctggaaacgaaggaaacatggttttacagccgctcacgccaagcgttatggcataaa
ggagaaacctcagggaacacgcaagccgtcaaaggtatccggtatgactgcgatcaagac
gcgctgctcgtactcgtagaaccgtcaggcccggcatgccacactggcagctacagctgt
tttacaaaggaacaaacagaagaacaggccgcggaccgattcggcatcatgaacgaactg
gagcgggtgatcgcggaacgccaagcggaaatgcctgaaggagcttacaccacgtacctc
ttccgtgaaggcgtcgataagattttgaaaaaagtcggagaagaagcatccgaagtcatc
atcgccgcgaaaaaccgggatcatgaggaactcaaatgggaagcggcagacctgctgtat
cacctgcttgtcctgctcagagaacaatccctgccgctggatgatgtgcttgacgtattg
aaaaaacgccattctgagattgaagagtaa

DBGET integrated database retrieval system