KEGG   Bacillus subtilis QB928: B657_36020Help
Entry
B657_36020        CDS       T02292                                 

Gene name
alsR
Definition
(GenBank) Transcriptional regulator (LysR family)
Organism
bsq  Bacillus subtilis QB928
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1 HTH_20 HTH_24
Motif
Other DBs
NCBI-ProteinID: AFQ59453
LinkDB All DBs
Position
3642939..3643847
Genome map
AA seq 302 aa AA seqDB search
MELRHLQYFIAVAEELHFGKAARRLNMTQPPLSQQIKQLEEEVGVTLLKRTKRFVELTAA
GEIFLNHCRMALMQIGQGIELAQRTARGEQGLLVIGFVGSATYEFLPPIVREYRKKFPSV
KIELREISSSRQQEELLKGNIDIGILHPPLQHTALHIETAQSSPCVLALPKQHPLTSKES
ITIEDLRDEPIITVAKEAWPTLYMDFIQFCEQAGFRPNIVQEATEYQMVIGLVSAGIGMT
FVPSSAKKLFNLDVTYRKMDQIQLNAEWVIAYRKDNHNPLIKHFIHISNCQQTRTKESDA
GT
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggagcttcgccatcttcaatactttatcgcagtagccgaagagcttcatttcggaaag
gctgcccggcggctgaacatgacgcagcctcctctcagccagcagatcaaacagctggag
gaagaagtcggagttacgcttctgaaaaggacaaaacgatttgtcgagcttaccgcagca
ggagaaatctttttaaatcattgccgcatggcattgatgcaaatcggacaaggaattgaa
ctggcacagcggacggcccgcggcgagcaaggccttctcgtaatcggttttgtcggatca
gctacatatgaatttctgccgccgattgtccgggaatatcgtaaaaaattcccatctgtg
aaaatagaactgcgtgaaatatcctcgtctaggcagcaggaggagctactaaagggcaac
attgatattggtatacttcatcctcccttacagcatacagctttacatatcgaaaccgcc
caaagcagcccttgtgttttagctttgcctaagcaacacccattgacttctaaggaatca
attacgattgaggatttaagagatgaaccaattattactgttgctaaagaagcatggcct
actctatacatggattttattcagttctgtgaacaagcgggcttcagacccaacattgtc
caggaagccacagaatatcaaatggtgattggtttagtcagtgccggaattggtatgaca
tttgttccttcctcggccaaaaaattatttaatttggatgttacttatcgaaaaatggac
caaatacagcttaatgcagaatgggttatcgcttaccgcaaagacaatcataatccgctt
ataaagcattttattcatatttcaaattgtcagcagacaagaactaaagagagtgatgca
ggtacatga

DBGET integrated database retrieval system