KEGG   Bacillus subtilis QB928: B657_40670Help
Entry
B657_40670        CDS       T02292                                 

Gene name
yybE
Definition
(GenBank) Putative transcriptional regulator (LysR family)
Organism
bsq  Bacillus subtilis QB928
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1
Motif
Other DBs
NCBI-ProteinID: AFQ59925
LinkDB All DBs
Position
4111797..4112675
Genome map
AA seq 292 aa AA seqDB search
MEWEQLEYFQTLARMQHVTKAAKSLSITQPALSRSIARLENHLGVPLFDRQGRSISLNQY
GHIFLRRVQAMMKEYTEGKEEIQALLKPDQGVVSLGFLHTLGTTLVPDLIGSFQQEYPNI
SFQLKQNHSYWLLERLKSGDLDLCLLASIKPENPIQWIKLWSEELFVFVPNDHPLASRES
ITLNEIAGERFILLKKGYALRMTVDELFEKANIQPNIMFEGEEATTAAGFVAAGLGISIL
PDLKGLDQSKITKIRVSWPECQRVIGIAWIKGRFLSPVAETFKQYVISHFSE
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
ttggaatgggaacaacttgaatattttcaaacactggcccggatgcagcacgtcacgaaa
gccgcaaaaagcctctccatcacacagcctgcactttcacgctctatcgccaggctggaa
aatcatttgggcgtcccgctatttgacaggcaaggacgatccatcagcttaaatcaatac
ggacacatttttttacgacgggttcaggcgatgatgaaggagtataccgaaggaaaagaa
gaaatccaagccttattaaagccagaccaaggcgtagtctctctcggttttttacataca
ttaggcaccacgctcgtgcccgatctcatcggctcctttcagcaggaataccccaacatt
tccttccagctgaagcaaaaccactcttattggctgcttgaacgattaaaatccggagat
ctggacctctgtctcctcgcttcgattaagcctgaaaatccgatccaatggatcaagctg
tggagtgaagaactctttgtatttgtgccaaatgatcacccattagccagtcgcgaaagc
attaccctgaatgagattgccggggagcgttttattttattgaaaaagggctatgcgctt
cggatgacggtcgatgagctgtttgagaaggccaatatacagccgaacattatgtttgaa
ggagaagaagcaactactgccgcaggttttgtggcagccggtctgggcatatctattctc
ccagacctgaaaggcttagaccaaagcaaaatcaccaaaatccgcgtcagctggccggaa
tgtcagcgtgtcataggaattgcctggataaaaggcaggtttttatcaccggttgctgag
acctttaaacaatatgtgatcagccatttttctgagtag

DBGET integrated database retrieval system