KEGG   Bacillus subtilis subsp. subtilis RO-NN-1: I33_0287Help
Entry
I33_0287          CDS       T01837                                 

Definition
(GenBank) aldehyde dehydrogenase, thermostable
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
bsr  Bacillus subtilis subsp. subtilis RO-NN-1
Pathway
bsr00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:bsr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    I33_0287
Enzymes [BR:bsr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     I33_0287
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AEP89307
LinkDB All DBs
Position
258137..259603
Genome map
AA seq 488 aa AA seqDB search
MSVITEQNTYLNFINGEWVKSQSGDMVKVENPADVNDIVGYVQNSTAEDVERAVAAANEA
KTAWRKLTGAERGQYLYKTADIMEQRLEEIAACATREMGKTLPEAKGETARGIAILRYYA
GEGMRKTGDVIPSTDKDALMFTTRVPLGVVGVISPWNFPVAIPIWKMAPALVYGNTVVIK
PATETAVTCAKIIACFEEAGLPAGVINLVTGPGSVVGQGLAEHEGVNAVTFTGSNQVGKI
IGQAALARGAKYQLEMGGKNPVIVADDADLEAAAEAVITGAFRSTGQKCTATSRAIVQSG
IYERFKEKLLQRTKDITIGDSLKEDVWMGPIASKNQLDNCLSYIEKGKQEGASLLIGGEK
LENGKYQNGYYVQPAIFDNVTSEMTIAQEEIFGPVIALIKVDSMEEALNIANDVKFGLSA
SIFTENIGRMLSFIDEIDAGLVRINAESAGVELQAPFGGMKQSSSHSREQGEAAKDFFTA
IKTVFVKP
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtgatcacggaacaaaacacgtacctcaactttattaacggagagtgggttaag
tctcaatcaggcgatatggtcaaggtcgaaaaccctgccgatgtgaatgatattgtcgga
tatgtacagaattcaacggctgaagatgtggaacgtgccgtcgccgccgccaatgaagcc
aaaacggcttggagaaagctgacgggtgctgagcgcggccaatacttatacaaaacagcg
gatatcatggagcagcgtttggaggaaatcgccgcctgtgcaacgcgagaaatgggtaaa
acactgccggaagcgaagggagaaacagcccgggggattgccattctgcgctattacgcc
ggagagggcatgcgaaaaacgggtgacgtcattccgtctactgacaaagatgcgctcatg
tttaccacccgtgttccgctcggtgtggtcggcgtgatttctccgtggaacttcccagtg
gcgattccgatttggaaaatggcgccggcattggtatacggcaataccgttgtcatcaaa
ccggcgacagaaacagctgtgacatgcgcgaagatcattgcctgctttgaggaagcgggg
cttccagcaggggtcatcaatttggtgacaggcccgggttctgttgtcgggcaggggctt
gctgagcatgagggtgtaaacgccgttacgtttaccggttcaaatcaagtcggaaaaatc
atcgggcaagccgctttagcgaggggagccaagtaccagcttgagatgggcggcaaaaac
cctgtcatcgtagctgatgacgctgaccttgaagctgcggccgaagctgtcataacgggg
gcctttcgttcaaccggccagaaatgcaccgcgacaagccgtgccatcgtacaaagcgga
atttatgagcgctttaaagaaaaactgctccagcgcacaaaagatattacaatcggcgac
agcttaaaagaggatgtctggatgggaccgattgccagcaagaatcagcttgataactgc
ctgtcatacattgagaaaggcaaacaggagggggcttcccttttaataggaggagaaaag
ctggagaacggaaagtatcaaaacggctattatgttcagcctgccatctttgacaatgtg
acatctgagatgacaattgcccaggaggaaattttcggtccggtgatcgccttgatcaag
gtggactcgatggaggaggcgctgaacatcgccaatgatgtgaagttcggattaagtgca
tccatcttcacggaaaacatcggccgaatgctttctttcattgatgaaatcgatgccgga
ctggttcggatcaatgcagaaagcgcaggtgttgagctgcaggcgccttttggcggcatg
aagcagtcgagctcccactcccgagaacagggtgaggcagcgaaggactttttcacagcg
atcaaaaccgtttttgtgaagccgtaa

DBGET integrated database retrieval system