KEGG   Bacillus subtilis subsp. subtilis RO-NN-1: I33_0379Help
Entry
I33_0379          CDS       T01837                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K09007  GTP cyclohydrolase IB [EC:3.5.4.16]
Organism
bsr  Bacillus subtilis subsp. subtilis RO-NN-1
Pathway
bsr00790  Folate biosynthesis
bsr01100  Metabolic pathways
Module
bsr_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bsr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    I33_0379
Enzymes [BR:bsr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     I33_0379
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCHY-1 DUF3091
Motif
Other DBs
NCBI-ProteinID: AEP89399
LinkDB All DBs
Position
354212..355126
Genome map
AA seq 304 aa AA seqDB search
MNQHTLLPKKTERLQYFGSVSPIKGEKPVEKEKMKDLQNIRKDYFFDIQHVGVANVSHPV
TITSAMMPAEQTTAANFTMTCNLPRNQKGINMSRLTELLQVYHQNGWVLSFSSLQQFTKE
LAENMDISSATVEVRFPWFFERKSPKLEKAGLMHADILMSVTYRKDQPFKQRAGISAKVT
TLCPCSKEISEYSAHNQRGTVSIWADIHPAASLPSDVKADLLHAAESNASARLHPVLKRP
DEKAVTETAYENPRFVEDLVRLIAADLFELEWVSAFEIECRNEESIHLHDAYAKLCFSKE
VDKI
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaacatacgctgctcccgaaaaaaacggagcgtcttcaatactttggatcggtc
agtccgatcaaaggcgagaaaccagtggaaaaagagaaaatgaaggacctgcaaaatatc
aggaaggattatttttttgacattcagcatgtaggtgtcgctaatgtgtcccatccagtc
acaatcacttctgccatgatgcctgccgagcaaacaacggctgcgaactttacaatgact
tgtaatttgccgagaaatcagaaggggattaatatgagccggttaacagagctgctgcaa
gtctatcatcaaaacggctgggttctctcattttcctctcttcagcaatttacgaaagag
cttgcagaaaacatggacatatcatctgccacagttgaagtgaggtttccgtggtttttc
gaacggaaaagcccgaagcttgagaaagcgggtttgatgcatgctgatatattgatgtct
gtcacctatcgcaaagatcagccgtttaaacagcgtgccggcatctcagcaaaagtaacg
actctgtgcccttgctccaaggaaatcagcgaatacagtgcccataatcagaggggaacg
gtcagcatttgggcggatattcacccggccgcatcgctgccaagtgatgttaaagctgat
ttgcttcacgccgcagaatcaaatgcctctgcgagactgcatccggtattgaagcggcct
gatgaaaaagccgtgacagaaacggcctatgaaaacccgagatttgttgaggatctcgtc
cggctgattgctgcagatttgtttgagcttgaatgggtgtcagcctttgagattgaatgc
cgcaatgaagaatcgatccatctccacgatgcctatgcgaagctgtgtttttcgaaggaa
gtggataaaatatga

DBGET integrated database retrieval system