KEGG   Bacillus subtilis subsp. subtilis RO-NN-1: I33_0381Help
Entry
I33_0381          CDS       T01837                                 

Definition
(GenBank) hypothetical protein
Organism
bsr  Bacillus subtilis subsp. subtilis RO-NN-1
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AEP89401
LinkDB All DBs
Position
355851..356027
Genome map
AA seq 58 aa AA seqDB search
MLETKPNLLSDEIFALFIGSATQVEQLLYASCGFPNVGKGRDLRWGKGLNAVGAFTDL
NT seq 177 nt NT seq  +upstreamnt  +downstreamnt
atgctggaaacgaaacccaatctgctttctgatgagatatttgcgcttttcatcggttca
gcaacgcaagtggagcaattgctttatgcaagctgcggttttccgaatgtcggcaagggc
agggatttgcgatggggaaaaggattaaacgcggttggagcctttacggatttataa

DBGET integrated database retrieval system