KEGG   Bacillus subtilis subsp. subtilis RO-NN-1: I33_0385Help
Entry
I33_0385          CDS       T01837                                 

Definition
(GenBank) YckB
  KO
K02424  L-cystine transport system substrate-binding protein
Organism
bsr  Bacillus subtilis subsp. subtilis RO-NN-1
Pathway
bsr02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsr00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    I33_0385
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsr02000]
    I33_0385
   02035 Bacterial motility proteins [BR:bsr02035]
    I33_0385
Transporters [BR:bsr02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Cystine transporter
    I33_0385
Bacterial motility proteins [BR:bsr02035]
 Flagellar system
  Flagellar assembly proteins
   Chaperones
    I33_0385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd NMT1 Phosphonate-bd
Motif
Other DBs
NCBI-ProteinID: AEP89405
LinkDB All DBs
Structure
PDB: 

Position
complement(358071..358922)
Genome map
AA seq 283 aa AA seqDB search
MHSKAVIFSFTMAFFLILAACSGKNEADSKDTGWEQIKDKGKIVVATSGTLYPTSYHDTD
SGSDKLTGYEVEVVREAAKRLGLKVEFKEMGIDGMLTAVNSGQVDAAANDIDVTKDREKK
FAFSTPYKYSYGTAIVRKDDLSGIKTLKDLKGKKAAGAATTVYMEVARKYGAKEVIYDNA
TNEQYLKDVANGRTDIILNDYYLQTIALAAFPDLNITIHPDIKYMPNKQALVMKKSNAAL
QKKMNEALKEMSKDGSLTKLSKQFFNKADVSKKIDADVQDVDL
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgcattccaaagccgttatattcagtttcacaatggctttctttcttatattggcagcc
tgttccggcaaaaatgaagccgattccaaggatacaggctgggagcagattaaggataaa
gggaaaatcgtagtcgctacatcaggcacgctctatcccacttcttatcacgatactgac
tctggctccgataagctgacgggctacgaggttgaagttgttcgtgaagcggcaaaacgc
ttggggctgaaggttgagttcaaggagatgggcattgatgggatgctgacagcggtgaac
agcggacaggttgacgcagccgcaaatgacatcgatgtcacgaaggaccgcgagaagaag
ttcgcattttccactccatataaatattcatacggcacggcaattgtccgaaaagatgat
ttatcagggattaaaacgctcaaggatttaaaagggaagaaagcggctggcgcggctaca
accgtctacatggaggtcgcgagaaaatacggcgccaaagaagtgatttatgataatgcg
acgaatgagcaatatttaaaagatgttgccaacggacgcactgacatcattttaaatgac
tattacctgcagacaattgcgctcgcggcattcccggatctcaacattacaattcatcct
gacatcaagtacatgccgaacaaacaggcccttgtcatgaaaaaaagcaatgcggcactt
cagaaaaagatgaacgaagcattgaaagagatgagcaaggatggctctttgactaaactg
tcgaaacaattcttcaataaagcagatgtatcaaaaaaaattgatgccgacgttcaggac
gttgatttgtaa

DBGET integrated database retrieval system