KEGG   Bacillus subtilis subsp. subtilis RO-NN-1: I33_0394Help
Entry
I33_0394          CDS       T01837                                 

Gene name
nucA
Definition
(GenBank) DNA-entry nuclease
Organism
bsr  Bacillus subtilis subsp. subtilis RO-NN-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNase_NucA_NucB Mycobact_memb
Motif
Other DBs
NCBI-ProteinID: AEP89414
LinkDB All DBs
Position
complement(363696..364145)
Genome map
AA seq 149 aa AA seqDB search
MNITTDIIKTILLVIVIIAAAAVGLIKGDFFSADQKTSQTKEYDETIAFPSDRYPETAKH
IKDAINEGHSEVCTIDRDGAEERREQSLKDVPSKKGYDRDEWPMAMCKEGGEGASVEYIS
PADNRGAGSWVGHQLTDYPDGTKVLFTIQ
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
gtgaacatcacgacggacatcataaaaacaatacttctcgtcatcgtcatcatagcagct
gcagctgtcggcctgataaaaggagactttttctcagctgatcaaaaaacgtctcaaacg
aaagaatatgatgaaacaatcgccttcccttctgaccgttatcccgaaacggccaagcat
attaaggatgcgataaatgaggggcactcagaggtgtgcactatcgacagagacggagct
gaggaacgccgcgagcaatcattaaaggacgtaccttccaaaaaggggtatgacagagat
gaatggccaatggccatgtgcaaagaaggcggtgagggagcttctgtagaatacatttct
cccgctgacaaccgcggagcaggctcttgggtcgggcatcagcttaccgattacccagac
ggcacaaaggttttattcacaattcagtaa

DBGET integrated database retrieval system