KEGG   Bacillus subtilis subsp. subtilis RO-NN-1: I33_0425Help
Entry
I33_0425          CDS       T01837                                 

Gene name
gerKB
Definition
(GenBank) spore germination protein KB
  KO
K06296  spore germination protein KB
Organism
bsr  Bacillus subtilis subsp. subtilis RO-NN-1
Brite
KEGG Orthology (KO) [BR:bsr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsr02000]
    I33_0425 (gerKB)
Transporters [BR:bsr02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   I33_0425 (gerKB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Spore_permease
Motif
Other DBs
NCBI-ProteinID: AEP89444
LinkDB All DBs
Position
414324..415445
Genome map
AA seq 373 aa AA seqDB search
MEKARISIRQLFVMIIIFELGSSLLITPGSMAGRDAWIAVLLGCAAGLFLFYLYQGIYQC
YPNSSPKEYMDDMLGTKLSWLFSFLYILYFAYIAARVLRDFGEMLLTFAYHDTPIIIVNG
LLVIVSIYAVRKGIEVLARAAELLFGAMYLLGAIGLVLIVVSGSIDPHNLKPVLADGFSP
VLYSVFTQTMYVPFGEVVLFVMIFPNLNDRKDVKKMGMIAIAISGLVVALTVAINISVLD
VDLTLRSQFPLLSTIQTIKVEEFLDRLDVFFMLALIIGGFFKVSLYLYATVVGTSTLFKE
KNPSQLAYPMGLGILILSITIATNFSEHLNEGLKVVPLYIHLPFQLLFPLFLFIVAVWKK
KRREKSKGTGAKK
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagccagaataagcataaggcagctgtttgtcatgattatcatttttgagctg
ggcagctccttattgattacaccgggatcaatggcgggcagggatgcttggatcgcagtt
ctgttggggtgtgcggccggtttgtttcttttctatttgtatcaaggcatttatcaatgt
taccccaattcttctccgaaagaatatatggatgatatgctgggaaccaagctgagctgg
ctgttttcatttctctatatcttgtactttgcctatattgccgcaagggtcctgcgtgac
tttggagaaatgcttctgacatttgcttatcatgatacacctatcattattgtaaatggt
ttattagtgatagttagcatatacgctgtaagaaaaggaatcgaagtgcttgcccgcgcg
gctgagctacttttcggagccatgtatttactgggcgcgatcggcctcgtgctgattgtt
gtctcaggttctatagacccgcataacttaaaaccggttttggcagacggcttttctcct
gtcctttactcagttttcactcagaccatgtacgttccgtttggcgaagtcgttttattt
gtgatgattttccctaacctgaatgacagaaaagatgtgaaaaaaatggggatgattgcc
atagctattagcggattggttgtggcgctcaccgtggcgattaatatcagcgtgcttgat
gttgatcttacactcagatcccagttcccgcttttaagcacgatccagacaatcaaggtc
gaagaatttttagaccggctcgatgtcttttttatgctggcgctgatcatcggcggcttc
tttaaggttagcctctacttatatgccactgtggttgggacatctacgctctttaaggaa
aagaacccctctcaattggcttatccgatgggattgggcatcttaatcctttctataacg
atcgcgactaacttttcagagcacttgaacgaaggcttgaaagtggtgccgctgtatatt
catttgccttttcaattattgtttccgctctttctgtttattgtggctgtttggaaaaag
aaacgaagagagaagtcaaaagggacaggagcaaaaaaatga

DBGET integrated database retrieval system