KEGG   Bacillus subtilis subsp. subtilis RO-NN-1: I33_1098
Entry
I33_1098          CDS       T01837                                 
Name
(GenBank) conserved hypothetical protein
Organism
bsr  Bacillus subtilis subsp. subtilis RO-NN-1
SSDB
Other DBs
NCBI-ProteinID: AEP90069
LinkDB
Position
1022895..1023101
AA seq 68 aa
MKSEWKEGLLCQGICVFIKQFHIGAANLLFCFRERFFRSDRALKSAVRNISVKKGMELTL
HAFFIYKI
NT seq 207 nt   +upstreamnt  +downstreamnt
atgaaatcagaatggaaggagggcttgctatgccaaggaatttgcgtgtttatcaaacag
tttcatattggcgcggcaaaccttttgttctgttttcgtgaacggttttttaggtcggac
cgcgcgctgaaaagcgctgtgcgtaacatatcggttaaaaaaggcatggagctgacgctt
catgccttttttatatacaaaatctaa

DBGET integrated database retrieval system