KEGG   Bacillus subtilis subsp. subtilis RO-NN-1: I33_1764Help
Entry
I33_1764          CDS       T01837                                 

Gene name
yloP
Definition
(GenBank) putative threonine/serine-protein kinase YloP
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bsr  Bacillus subtilis subsp. subtilis RO-NN-1
Brite
KEGG Orthology (KO) [BR:bsr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bsr01001]
    I33_1764 (yloP)
Enzymes [BR:bsr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     I33_1764 (yloP)
Protein kinases [BR:bsr01001]
 Serine/threonine kinases: Other
  Bacterial family
   I33_1764 (yloP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Kinase-like Kdo Haspin_kinase RIO1 Seadorna_VP7 Pkinase_fungal PBP1_TM
Motif
Other DBs
NCBI-ProteinID: AEP90730
LinkDB All DBs
Position
1625620..1627566
Genome map
AA seq 648 aa AA seqDB search
MLIGKRISGRYQILRVIGGGGMANVYLAEDIILDREVAIKILRFDYANDNEFIRRFRREA
QSASSLDHPNIVSIYDLGEEDDIYYIVMEYVEGMTLKEYITANGPLHPKEALNIMEQIVS
AIAHAHQNQIVHRDIKPHNILIDHMGNIKVTDFGIATALSSTTITHTNSVLGSVHYLSPE
QARGGLATKKSDIYALGIVLFELLTGRIPFDGESAVSIALKHLQAETPSTKRWNPSVPQS
VENIILKATAKDPFHRYETAEDMEADIKTAFDADRLNEKRFTIQEDEEMTKAIPIIKDEE
LAKAAGEKEAEVTTAQENKTKKNGKRKKWPWVLLTICLVFITAGILAVTVFPSLFMPKDV
KIPDVSGMEYEKAAGLLEKEGLQVDSEVLEISDEKIEEGLMVKTDPKADTTVKEGATVTL
YKSTGKAKTEIGDVTGQTVDQAKKALKDQGFKHVTVNEVNDEKNAGTVIDQNPSAGTELV
PSEDQVKLTVSIGPEDITLRDLKTYSKEAASGYLEDNGLKLVEKEAYSDDVPEGQVVKQK
PAAGTAVKPGNEVEVTFSLGPEKKPAKTVKEKVKIPYEPENEGDELQVQIAVDDADHSIS
DTYEEFKIKEPTERTIELKIEPGQKGYYQVMVNNKVVSYKTIEYPKDE
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
gtgctaatcggcaagcggatcagcgggcgttaccaaattctccgcgttataggcggcggg
ggaatggccaacgtgtatttagctgaggatatcattctagaccgtgaagtcgcaattaaa
atcctgcggtttgactatgcaaatgacaatgaatttatcagacgtttccgcagagaagcc
caatccgcatcaagcctcgatcacccgaatattgtcagcatttacgatttgggcgaggaa
gatgatatttattatattgtcatggaatacgttgaaggcatgacgcttaaagaatacata
acagcaaatgggccgcttcaccctaaagaagcgctgaacatcatggagcaaattgtctca
gccatcgctcatgcccatcaaaaccagattgttcacagagacatcaagccgcataacatt
ttgattgatcatatgggaaatatcaaagtaacggattttggaattgcgacggcactaagt
tcgaccacaatcacccataccaattcagttctgggctcggtccattacttatcacctgaa
caggcccggggcggcttagccacaaaaaaatcggatatttatgcgcttggaatcgttcta
tttgagcttttaaccggccgtattccgtttgatggagagtcagcagtcagcatcgccttg
aagcatcttcaagcggaaactccttcgacaaaaaggtggaatccatcggtcccccaaagc
gttgaaaacatcatactcaaggcaactgccaaagatccttttcatcgctacgaaacggct
gaagacatggaagcagacataaaaacggcttttgatgccgacagactcaatgaaaagaga
tttacgattcaagaagatgaagaaatgacaaaagcgatacctatcattaaagatgaagaa
ctcgctaaagctgctggcgaaaaagaagctgaagtgacaaccgctcaagaaaacaaaaca
aagaagaacggcaaaagaaaaaagtggccgtgggttttgctcacgatatgcctcgttttt
atcacagctggaattcttgctgtcactgtttttccgtcgcttttcatgcctaaggatgtc
aaaatacctgatgtctccggaatggaatacgaaaaagccgcagggctcttggaaaaagaa
ggtttacaggttgattccgaggtgttggaaatctcagatgaaaaaattgaagagggcctg
atggtaaaaacggatcctaaagcggataccacagtcaaagaaggcgccacggtcaccctt
tataagagcaccggaaaagcaaaaacggagatcggtgatgtgacaggccaaacggtcgac
caggcaaaaaaagcgttgaaggaccaagggtttaaacatgtaacggtaaatgaagtgaat
gacgagaaaaatgcgggcactgtcattgaccaaaatccttcagcagggactgagcttgtc
ccgagtgaagatcaagtcaaacttacagtcagtatcggacccgaagacattacgcttaga
gacttgaaaacctacagtaaagaagcagcgtctggatatctggaagacaacggattgaag
cttgtagaaaaagaagcatactcagatgatgttccagaaggacaggttgtcaaacaaaaa
ccagcagcaggtacggcagtaaagccgggaaacgaagttgaagtgacattctctctcgga
ccagagaaaaaacctgcgaaaacagtgaaagaaaaggtcaagatcccctacgaaccagaa
aatgaaggggacgagcttcaagtgcaaatcgcggttgacgatgcggatcacagcatctct
gacacttacgaagaatttaagataaaagagccgactgaacgaacgattgaactaaagatt
gaacccggccaaaaagggtactatcaagtaatggtaaacaataaagttgtcagctacaaa
accattgagtatccgaaagatgaataa

DBGET integrated database retrieval system