KEGG   Bacillus subtilis subsp. subtilis RO-NN-1: I33_2745
Entry
I33_2745          CDS       T01837                                 

Definition
(GenBank) fructose permease IID component
  KO
K02771  fructose PTS system EIID component
Organism
bsr  Bacillus subtilis subsp. subtilis RO-NN-1
Pathway
bsr00051  Fructose and mannose metabolism
bsr02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bsr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    I33_2745
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    I33_2745
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsr02000]
    I33_2745
Transporters [BR:bsr02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    I33_2745
SSDB
Motif
Pfam: EIID-AGA
Other DBs
NCBI-ProteinID: AEP91690
LinkDB
Position
complement(2560471..2561298)
AA seq 275 aa
MEKEKRLTKKEIFSMFIRSNFLLGSFNFERVQAMGYCYVMIPAIKKLYGPGAKRNEALQR
HLEWFNTHPWLTAPIFGVTAAMEEEMANNKGIDGKAISGMKIGLMGPIAGVGDPIFWGTI
RPVLAALGASLALGGNIAGPLLFFFLLNAIRLSTKYYGLKYGYVKGMEILQDLAGNRIQK
LTEGASILGLFVMGALVSKWTTINIPIVVSRIKDESGKVDVQTVQNVLDSIMPGALPLGL
TLLVAWMLRKGVNPLLIICGIFVIGILGYWAGFLA
NT seq 828 nt   +upstreamnt  +downstreamnt
atggagaaagaaaaacgattaacgaaaaaagaaattttcagcatgtttattcgttcaaat
tttttactcggttcctttaacttcgaacgtgtgcaggcaatgggatattgttatgtcatg
ataccggcgatcaaaaaattgtacggtcccggagcgaaaagaaacgaagccttgcagcgg
catttggaatggtttaatacacatccgtggctgacagcgcctatatttggcgtgacggca
gccatggaagaagaaatggcgaacaataaaggaattgacggaaaagcgataagcggaatg
aaaatcggtttgatgggaccaatagcgggcgtaggcgacccgattttctggggaacgatt
cgtcctgtcttagctgcgctaggagcctcccttgctttaggaggaaacattgccggccct
ttgctattctttttcttgctgaatgccataagattaagcacaaaatattacggattaaag
tatggctatgtgaaaggaatggagattcttcaggatttagcggggaatcgcattcaaaag
cttacagagggcgcttcgattctcgggttatttgttatgggggctctcgtgtccaaatgg
accaccatcaacattccaatcgttgtatccaggattaaggatgaaagcggaaaagtagat
gttcaaactgtacaaaacgtgttagacagcattatgccgggtgcgctgcctctcggattg
acattattggtggcatggatgcttcgcaaaggggtgaatcctcttctcattatttgcggc
atctttgtcatcggaattctcgggtattgggctggattcctagcataa

DBGET integrated database retrieval system